BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 042014
(169 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1DH3|A Chain A, Crystal Structure Of A Creb Bzip-Cre Complex Reveals The
Basis For Creb Faimly Selective Dimerization And Dna
Binding
pdb|1DH3|C Chain C, Crystal Structure Of A Creb Bzip-Cre Complex Reveals The
Basis For Creb Faimly Selective Dimerization And Dna
Binding
Length = 55
Score = 35.8 bits (81), Expect = 0.013, Method: Compositional matrix adjust.
Identities = 16/48 (33%), Positives = 32/48 (66%)
Query: 73 RMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCH 120
R++ NRE+AR SR +K++++ L ++V L N+N L+++L + +
Sbjct: 5 RLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4-
Methylpyrazole
pdb|3E4E|B Chain B, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4-
Methylpyrazole
pdb|3E6I|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor
Indazole
pdb|3E6I|B Chain B, Human Cytochrome P450 2e1 In Complex With The Inhibitor
Indazole
pdb|3GPH|A Chain A, Human Cytochrome P450 2e1 In Complex With
Omega-Imidazolyl-Decanoic Acid
pdb|3GPH|B Chain B, Human Cytochrome P450 2e1 In Complex With
Omega-Imidazolyl-Decanoic Acid
pdb|3KOH|A Chain A, Cytochrome P450 2e1 With Omega-Imidazolyl Octanoic Acid
pdb|3KOH|B Chain B, Cytochrome P450 2e1 With Omega-Imidazolyl Octanoic Acid
pdb|3LC4|A Chain A, Human Cytochrome P450 2e1 In Complex With
Omega-Imidazolyl-Dodecanoic Acid
pdb|3LC4|B Chain B, Human Cytochrome P450 2e1 In Complex With
Omega-Imidazolyl-Dodecanoic Acid
pdb|3T3Z|A Chain A, Human Cytochrome P450 2e1 In Complex With Pilocarpine
pdb|3T3Z|B Chain B, Human Cytochrome P450 2e1 In Complex With Pilocarpine
pdb|3T3Z|C Chain C, Human Cytochrome P450 2e1 In Complex With Pilocarpine
pdb|3T3Z|D Chain D, Human Cytochrome P450 2e1 In Complex With Pilocarpine
Length = 476
Score = 28.1 bits (61), Expect = 2.4, Method: Compositional matrix adjust.
Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 15/63 (23%)
Query: 89 QKHLD---ELWSQVVWLRNENHQLVDK------------LNHVSGCHDKVIQENAELKVE 133
+KH D E + ++++L NEN L+ L+++ G H KVI+ AE+K
Sbjct: 165 RKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEY 224
Query: 134 ATE 136
+E
Sbjct: 225 VSE 227
>pdb|1GD2|E Chain E, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
To Dna
pdb|1GD2|F Chain F, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
To Dna
pdb|1GD2|G Chain G, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
To Dna
pdb|1GD2|H Chain H, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
To Dna
pdb|1GD2|I Chain I, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
To Dna
pdb|1GD2|J Chain J, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
To Dna
Length = 70
Score = 27.3 bits (59), Expect = 4.0, Method: Compositional matrix adjust.
Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 7/52 (13%)
Query: 72 RRMISNRESARRSRMRKQKHLDELWSQVVWLRN-------ENHQLVDKLNHV 116
+R NR + R R RK+ HL L +QVV L+ EN QL K+ +
Sbjct: 11 KRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQLRQKVRQL 62
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.131 0.381
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,123,658
Number of Sequences: 62578
Number of extensions: 129171
Number of successful extensions: 295
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 292
Number of HSP's gapped (non-prelim): 10
length of query: 169
length of database: 14,973,337
effective HSP length: 92
effective length of query: 77
effective length of database: 9,216,161
effective search space: 709644397
effective search space used: 709644397
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)