BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042014
         (169 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1DH3|A Chain A, Crystal Structure Of A Creb Bzip-Cre Complex Reveals The
           Basis For Creb Faimly Selective Dimerization And Dna
           Binding
 pdb|1DH3|C Chain C, Crystal Structure Of A Creb Bzip-Cre Complex Reveals The
           Basis For Creb Faimly Selective Dimerization And Dna
           Binding
          Length = 55

 Score = 35.8 bits (81), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 73  RMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHVSGCH 120
           R++ NRE+AR SR +K++++  L ++V  L N+N  L+++L  +   +
Sbjct: 5   RLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52


>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4-
           Methylpyrazole
 pdb|3E4E|B Chain B, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4-
           Methylpyrazole
 pdb|3E6I|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor
           Indazole
 pdb|3E6I|B Chain B, Human Cytochrome P450 2e1 In Complex With The Inhibitor
           Indazole
 pdb|3GPH|A Chain A, Human Cytochrome P450 2e1 In Complex With
           Omega-Imidazolyl-Decanoic Acid
 pdb|3GPH|B Chain B, Human Cytochrome P450 2e1 In Complex With
           Omega-Imidazolyl-Decanoic Acid
 pdb|3KOH|A Chain A, Cytochrome P450 2e1 With Omega-Imidazolyl Octanoic Acid
 pdb|3KOH|B Chain B, Cytochrome P450 2e1 With Omega-Imidazolyl Octanoic Acid
 pdb|3LC4|A Chain A, Human Cytochrome P450 2e1 In Complex With
           Omega-Imidazolyl-Dodecanoic Acid
 pdb|3LC4|B Chain B, Human Cytochrome P450 2e1 In Complex With
           Omega-Imidazolyl-Dodecanoic Acid
 pdb|3T3Z|A Chain A, Human Cytochrome P450 2e1 In Complex With Pilocarpine
 pdb|3T3Z|B Chain B, Human Cytochrome P450 2e1 In Complex With Pilocarpine
 pdb|3T3Z|C Chain C, Human Cytochrome P450 2e1 In Complex With Pilocarpine
 pdb|3T3Z|D Chain D, Human Cytochrome P450 2e1 In Complex With Pilocarpine
          Length = 476

 Score = 28.1 bits (61), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 15/63 (23%)

Query: 89  QKHLD---ELWSQVVWLRNENHQLVDK------------LNHVSGCHDKVIQENAELKVE 133
           +KH D   E + ++++L NEN  L+              L+++ G H KVI+  AE+K  
Sbjct: 165 RKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEY 224

Query: 134 ATE 136
            +E
Sbjct: 225 VSE 227


>pdb|1GD2|E Chain E, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
           To Dna
 pdb|1GD2|F Chain F, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
           To Dna
 pdb|1GD2|G Chain G, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
           To Dna
 pdb|1GD2|H Chain H, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
           To Dna
 pdb|1GD2|I Chain I, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
           To Dna
 pdb|1GD2|J Chain J, Crystal Structure Of Bzip Transcription Factor Pap1 Bound
           To Dna
          Length = 70

 Score = 27.3 bits (59), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 72  RRMISNRESARRSRMRKQKHLDELWSQVVWLRN-------ENHQLVDKLNHV 116
           +R   NR + R  R RK+ HL  L +QVV L+        EN QL  K+  +
Sbjct: 11  KRKAQNRAAQRAFRKRKEDHLKALETQVVTLKELHSSTTLENDQLRQKVRQL 62


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.131    0.381 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,123,658
Number of Sequences: 62578
Number of extensions: 129171
Number of successful extensions: 295
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 292
Number of HSP's gapped (non-prelim): 10
length of query: 169
length of database: 14,973,337
effective HSP length: 92
effective length of query: 77
effective length of database: 9,216,161
effective search space: 709644397
effective search space used: 709644397
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)