BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042059
         (185 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8
          Length = 101

 Score = 28.9 bits (63), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 4/41 (9%)

Query: 145 GKLVCP----VCLGTGLPNNKGLLRRPDARKLLDKMYNGRL 181
           GK++C     V L TG+P      R P  RKLL+ ++NG L
Sbjct: 59  GKVICGSRVRVELSTGMPRRSRFDRPPARRKLLEVLFNGPL 99


>pdb|3LCZ|A Chain A, B.Licheniformis Anti-Trap Can Assemble Into Two Types Of
           Dodecameric Particles With The Same Symmetry But
           Inverted Orientation Of Trimers
 pdb|3LCZ|B Chain B, B.Licheniformis Anti-Trap Can Assemble Into Two Types Of
           Dodecameric Particles With The Same Symmetry But
           Inverted Orientation Of Trimers
 pdb|3LCZ|C Chain C, B.Licheniformis Anti-Trap Can Assemble Into Two Types Of
           Dodecameric Particles With The Same Symmetry But
           Inverted Orientation Of Trimers
 pdb|3LCZ|D Chain D, B.Licheniformis Anti-Trap Can Assemble Into Two Types Of
           Dodecameric Particles With The Same Symmetry But
           Inverted Orientation Of Trimers
 pdb|3LD0|A Chain A, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|B Chain B, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|C Chain C, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|D Chain D, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|E Chain E, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|F Chain F, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|G Chain G, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|H Chain H, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|I Chain I, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|J Chain J, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|K Chain K, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|L Chain L, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|M Chain M, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|N Chain N, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|O Chain O, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|P Chain P, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|Q Chain Q, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|R Chain R, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|S Chain S, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|T Chain T, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|U Chain U, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|V Chain V, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|W Chain W, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|X Chain X, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|Y Chain Y, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|Z Chain Z, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|1 Chain 1, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|2 Chain 2, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|3 Chain 3, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|4 Chain 4, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|5 Chain 5, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|6 Chain 6, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|7 Chain 7, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|8 Chain 8, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|9 Chain 9, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|AA Chain a, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|BB Chain b, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|CC Chain c, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|DD Chain d, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|EE Chain e, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|FF Chain f, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|GG Chain g, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|HH Chain h, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|II Chain i, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|JJ Chain j, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|KK Chain k, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|LL Chain l, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
 pdb|3LD0|MM Chain m, Crystal Structure Of B.Licheniformis Anti-Trap Protein, An
           Antagonist Of Trap-Rna Interactions
          Length = 53

 Score = 27.7 bits (60), Expect = 3.6,   Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 3/25 (12%)

Query: 136 TECPNCYGRGK---LVCPVCLGTGL 157
           T CPNC G G+     CP CLG G+
Sbjct: 10  TTCPNCNGSGREEPEPCPKCLGKGV 34


>pdb|1NLT|A Chain A, The Crystal Structure Of Hsp40 Ydj1
          Length = 248

 Score = 27.7 bits (60), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 12/77 (15%)

Query: 100 VCRNC----GGSGAVL-CDMCGGTGKWKALNRKRAKDVYEF-TECPNCYGRGKLV----- 148
           +C+ C    G  GAV  C  C G G  K + R+    +  F TEC  C+G G ++     
Sbjct: 40  LCKECEGRGGKKGAVKKCTSCNGQG-IKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDR 98

Query: 149 CPVCLGTGLPNNKGLLR 165
           C  C G  + N + +L 
Sbjct: 99  CKSCNGKKVENERKILE 115


>pdb|1MYP|C Chain C, X-Ray Crystal Structure Of Canine Myeloperoxidase At 3
           Angstroms Resolution
 pdb|1MYP|D Chain D, X-Ray Crystal Structure Of Canine Myeloperoxidase At 3
           Angstroms Resolution
 pdb|1MHL|C Chain C, Crystal Structure Of Human Myeloperoxidase Isoform C
           Crystallized In Space Group P2(1) At Ph 5.5 And 20 Deg C
 pdb|1MHL|D Chain D, Crystal Structure Of Human Myeloperoxidase Isoform C
           Crystallized In Space Group P2(1) At Ph 5.5 And 20 Deg C
          Length = 466

 Score = 26.9 bits (58), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 28/61 (45%)

Query: 43  FGVSDSSSEPRKPKESRVLISRRKCLTCICSTIALISNSGSLVSVPEAIALDGKERPVCR 102
           F +    ++PR   ++  +   R C  C  S I + +   +L S  +A  + G E P+ R
Sbjct: 14  FPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLAR 73

Query: 103 N 103
           N
Sbjct: 74  N 74


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.432 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,440,095
Number of Sequences: 62578
Number of extensions: 219546
Number of successful extensions: 510
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 507
Number of HSP's gapped (non-prelim): 9
length of query: 185
length of database: 14,973,337
effective HSP length: 93
effective length of query: 92
effective length of database: 9,153,583
effective search space: 842129636
effective search space used: 842129636
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)