BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 042077
(109 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2XPI|A Chain A, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1
pdb|2XPI|D Chain D, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1
Length = 597
Score = 32.7 bits (73), Expect = 0.058, Method: Compositional matrix adjust.
Identities = 20/70 (28%), Positives = 28/70 (40%)
Query: 25 LRGLVRDCVSKHLYSSAIFFADKIAALTNDPTGVYMQAQALFLGRHYRRPFHLLNASKIV 84
LR D + + Y A F +K+ +T +P + AQ Y R LL +
Sbjct: 87 LRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY 146
Query: 85 PRDLRFRYLA 94
R RYLA
Sbjct: 147 NRSSACRYLA 156
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.139 0.403
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,075,092
Number of Sequences: 62578
Number of extensions: 108490
Number of successful extensions: 289
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 287
Number of HSP's gapped (non-prelim): 4
length of query: 109
length of database: 14,973,337
effective HSP length: 73
effective length of query: 36
effective length of database: 10,405,143
effective search space: 374585148
effective search space used: 374585148
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)