Query         042177
Match_columns 123
No_of_seqs    15 out of 17
Neff          1.5 
Searched_HMMs 46136
Date          Fri Mar 29 03:34:11 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042177.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042177hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG5129 MAK16 Nuclear protein   93.4   0.035 7.7E-07   46.9   1.2   10    3-12    110-119 (303)
  2 KOG1189 Global transcriptional  92.0   0.096 2.1E-06   49.7   2.1   18   30-48    739-756 (960)
  3 PF09026 CENP-B_dimeris:  Centr  90.4   0.081 1.8E-06   39.1   0.0    9   93-101    11-19  (101)
  4 KOG3064 RNA-binding nuclear pr  88.1    0.15 3.2E-06   43.5  -0.1   17    3-19    111-127 (303)
  5 KOG2236 Uncharacterized conser  86.5     0.8 1.7E-05   41.0   3.6    9   69-77     91-99  (483)
  6 PTZ00007 (NAP-L) nucleosome as  83.9       1 2.2E-05   37.9   2.9   12  109-120   307-318 (337)
  7 PF02724 CDC45:  CDC45-like pro  78.3     1.7 3.8E-05   38.3   2.5    7   50-56     55-61  (622)
  8 KOG1060 Vesicle coat complex A  77.5     2.2 4.7E-05   41.0   3.1    8    3-10    563-570 (968)
  9 PF05285 SDA1:  SDA1;  InterPro  73.0     2.3 5.1E-05   34.5   1.8    8   11-18     27-34  (324)
 10 PF09073 BUD22:  BUD22;  InterP  71.3     3.5 7.6E-05   34.5   2.5    9   11-19    137-145 (432)
 11 PHA02664 hypothetical protein;  70.3     3.5 7.5E-05   37.1   2.4    6   64-69    404-409 (534)
 12 PF10488 PP1c_bdg:  Phosphatase  68.0     3.1 6.8E-05   35.4   1.6   20   73-92     17-36  (307)
 13 KOG1834 Calsyntenin [Extracell  67.4     3.2 6.9E-05   39.7   1.6   13   71-83    881-893 (952)
 14 KOG4264 Nucleo-cytoplasmic pro  61.1     7.7 0.00017   36.2   2.8   21   63-83     45-68  (694)
 15 KOG2925 Predicted translation   57.0     9.6 0.00021   30.4   2.4   11   91-101   129-139 (167)
 16 KOG1832 HIV-1 Vpr-binding prot  57.0     7.5 0.00016   38.7   2.1   18   77-94   1395-1413(1516)
 17 KOG0330 ATP-dependent RNA heli  55.2     3.9 8.6E-05   36.8  -0.0   24   53-76    102-125 (476)
 18 KOG1425 Microfibrillar-associa  54.4     5.8 0.00013   35.4   0.9   13  107-119   170-182 (430)
 19 KOG0943 Predicted ubiquitin-pr  53.4      10 0.00022   39.4   2.5    6   76-81   1724-1729(3015)
 20 PF14998 Ripply:  Transcription  52.0     7.2 0.00016   28.0   0.9   14   78-91     72-85  (87)
 21 KOG2141 Protein involved in hi  51.9     9.9 0.00021   36.2   2.0    9   34-42    177-185 (822)
 22 PF01056 Myc_N:  Myc amino-term  49.4     5.6 0.00012   33.5   0.0   15  108-122   232-246 (329)
 23 KOG2140 Uncharacterized conser  43.1      15 0.00032   34.6   1.7   11    5-15    583-593 (739)
 24 KOG2140 Uncharacterized conser  39.0      20 0.00044   33.8   1.9   16   59-74    618-633 (739)
 25 PRK09993 C-lysozyme inhibitor;  32.2      31 0.00067   26.9   1.7   49    4-54      3-59  (153)
 26 KOG0127 Nucleolar protein fibr  30.3      34 0.00074   32.2   1.9    8   29-36     98-105 (678)
 27 KOG0943 Predicted ubiquitin-pr  29.6      41 0.00089   35.3   2.4   13   73-85   1728-1740(3015)
 28 PF08706 D5_N:  D5 N terminal l  29.3      21 0.00045   23.4   0.3   22   63-84     96-117 (150)
 29 PF00981 Rota_NS53:  Rotavirus   28.9      50  0.0011   30.1   2.6   34    2-35    336-370 (488)
 30 PF09849 DUF2076:  Uncharacteri  28.4 2.3E+02   0.005   23.0   6.1    9    7-15    154-162 (247)
 31 KOG4364 Chromatin assembly fac  27.8      49  0.0011   31.7   2.5   20   58-77    478-500 (811)
 32 KOG3540 Beta amyloid precursor  27.2      59  0.0013   30.3   2.8   24   51-74    161-184 (615)
 33 KOG1076 Translation initiation  25.2      31 0.00068   33.1   0.8    6   87-92     10-15  (843)
 34 COG5058 LAG1 Protein transport  24.7      40 0.00086   30.0   1.3    6    5-10    276-281 (395)
 35 PF08453 Peptidase_M9_N:  Pepti  24.3      12 0.00025   28.3  -1.8   45   32-77    105-149 (190)
 36 KOG3555 Ca2+-binding proteogly  23.8      57  0.0012   29.3   2.1    7  107-113   418-424 (434)
 37 KOG2270 Serine/threonine prote  23.7      64  0.0014   29.6   2.4   11   69-79    420-430 (520)
 38 KOG2959 Transcriptional regula  23.6      58  0.0013   27.3   2.0   31   88-119    48-78  (238)
 39 KOG2652 RNA polymerase II tran  23.2      72  0.0016   27.9   2.5    8   68-75    240-247 (348)
 40 KOG0262 RNA polymerase I, larg  22.8      66  0.0014   33.0   2.5   14    7-20   1281-1294(1640)
 41 KOG0347 RNA helicase [RNA proc  22.8      31 0.00067   32.7   0.3   20   53-72    223-242 (731)
 42 PF08401 DUF1738:  Domain of un  22.8      40 0.00086   23.7   0.8   28   11-38     48-75  (125)
 43 KOG3228 Uncharacterized conser  21.6      45 0.00097   27.8   0.9    7  107-113   118-124 (226)
 44 PF03419 Peptidase_U4:  Sporula  21.6      81  0.0018   24.6   2.3   22    6-27      9-30  (293)
 45 KOG1461 Translation initiation  21.5      59  0.0013   30.6   1.8   42   35-76    424-476 (673)
 46 KOG2147 Nucleolar protein invo  20.8      72  0.0016   30.7   2.2   13   74-86    312-324 (823)
 47 PHA03151 hypothetical protein;  20.2      85  0.0019   26.5   2.3   11   33-43     35-45  (259)
 48 KOG0340 ATP-dependent RNA heli  20.2      37  0.0008   30.5   0.2   18   57-74     52-69  (442)
 49 TIGR02854 spore_II_GA sigma-E   20.1      89  0.0019   25.0   2.3   20    6-25      9-28  (288)

No 1  
>COG5129 MAK16 Nuclear protein with HMG-like acidic region [General function prediction only]
Probab=93.41  E-value=0.035  Score=46.92  Aligned_cols=10  Identities=40%  Similarity=0.673  Sum_probs=5.4

Q ss_pred             hhHHHHHHHH
Q 042177            3 RITKMFNVLM   12 (123)
Q Consensus         3 ritkmfnvlm   12 (123)
                      |+||+-.+|+
T Consensus       110 rltkLTQyll  119 (303)
T COG5129         110 RLTKLTQYLL  119 (303)
T ss_pred             HHHHHHHHHH
Confidence            4556555553


No 2  
>KOG1189 consensus Global transcriptional regulator, cell division control protein [Amino acid transport and metabolism]
Probab=91.97  E-value=0.096  Score=49.75  Aligned_cols=18  Identities=39%  Similarity=0.562  Sum_probs=10.0

Q ss_pred             CcccccCccccccccccch
Q 042177           30 DEDIFKQPQVRDQGERGVS   48 (123)
Q Consensus        30 dedifkqpqvrdqgergvs   48 (123)
                      .+--|++| .|+-|-.||.
T Consensus       739 ~~~efd~p-fr~lGF~GvP  756 (960)
T KOG1189|consen  739 SELEFDVP-FRELGFNGVP  756 (960)
T ss_pred             cceeeccc-hhhcCcCCCC
Confidence            34446554 5666666653


No 3  
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=90.39  E-value=0.081  Score=39.12  Aligned_cols=9  Identities=56%  Similarity=0.841  Sum_probs=0.0

Q ss_pred             CCCCCCCCC
Q 042177           93 ESESEPDPD  101 (123)
Q Consensus        93 dSESEseSD  101 (123)
                      +|++|+|.|
T Consensus        11 dse~dsdEd   19 (101)
T PF09026_consen   11 DSESDSDED   19 (101)
T ss_dssp             ---------
T ss_pred             ccccccccc
Confidence            333333333


No 4  
>KOG3064 consensus RNA-binding nuclear protein (MAK16) containing a distinct C4 Zn-finger [RNA processing and modification]
Probab=88.11  E-value=0.15  Score=43.46  Aligned_cols=17  Identities=35%  Similarity=0.507  Sum_probs=10.0

Q ss_pred             hhHHHHHHHHHHHHHHH
Q 042177            3 RITKMFNVLMNLFLLVL   19 (123)
Q Consensus         3 ritkmfnvlmnlfllvl   19 (123)
                      |+|||-.+|.-+=-|.|
T Consensus       111 RltklTQylir~rklal  127 (303)
T KOG3064|consen  111 RLTKLTQYLIRMRKLAL  127 (303)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            56777666665544443


No 5  
>KOG2236 consensus Uncharacterized conserved protein [Function unknown]
Probab=86.53  E-value=0.8  Score=41.03  Aligned_cols=9  Identities=22%  Similarity=0.157  Sum_probs=4.1

Q ss_pred             chhhhhccc
Q 042177           69 PLVNATVNY   77 (123)
Q Consensus        69 Pi~N~~~~y   77 (123)
                      ++|.-++.|
T Consensus        91 d~vd~~~~g   99 (483)
T KOG2236|consen   91 DLVDPILVG   99 (483)
T ss_pred             cccchhhcC
Confidence            344444444


No 6  
>PTZ00007 (NAP-L) nucleosome assembly protein -L; Provisional
Probab=83.93  E-value=1  Score=37.89  Aligned_cols=12  Identities=25%  Similarity=0.498  Sum_probs=4.6

Q ss_pred             ccccccccCCCC
Q 042177          109 ESESESESESEP  120 (123)
Q Consensus       109 dseSdSesDSEs  120 (123)
                      |++|+++.++++
T Consensus       307 ~~~~~~~~~~~~  318 (337)
T PTZ00007        307 DSNSDVDTNEED  318 (337)
T ss_pred             cccccccccccc
Confidence            333333333333


No 7  
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=78.27  E-value=1.7  Score=38.29  Aligned_cols=7  Identities=29%  Similarity=0.472  Sum_probs=3.6

Q ss_pred             heeccch
Q 042177           50 VVTAGLG   56 (123)
Q Consensus        50 vvtaglg   56 (123)
                      ||..|+|
T Consensus        55 vilIncG   61 (622)
T PF02724_consen   55 VILINCG   61 (622)
T ss_pred             EEEEecC
Confidence            5555554


No 8  
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport]
Probab=77.51  E-value=2.2  Score=41.05  Aligned_cols=8  Identities=13%  Similarity=0.181  Sum_probs=4.2

Q ss_pred             hhHHHHHH
Q 042177            3 RITKMFNV   10 (123)
Q Consensus         3 ritkmfnv   10 (123)
                      |+.||+++
T Consensus       563 RF~r~l~~  570 (968)
T KOG1060|consen  563 RFLRQLIS  570 (968)
T ss_pred             HHHHHHhc
Confidence            55555543


No 9  
>PF05285 SDA1:  SDA1;  InterPro: IPR007949 This domain consists of several SDA1 protein homologues. SDA1 is a Saccharomyces cerevisiae protein which is involved in the control of the actin cytoskeleton. The protein is essential for cell viability and is localised in the nucleus [].
Probab=73.02  E-value=2.3  Score=34.52  Aligned_cols=8  Identities=63%  Similarity=0.820  Sum_probs=3.8

Q ss_pred             HHHHHHHH
Q 042177           11 LMNLFLLV   18 (123)
Q Consensus        11 lmnlfllv   18 (123)
                      |+|||==|
T Consensus        27 li~l~Rev   34 (324)
T PF05285_consen   27 LINLFREV   34 (324)
T ss_pred             HHHHHHHH
Confidence            45555433


No 10 
>PF09073 BUD22:  BUD22;  InterPro: IPR015158 BUD22 has been shown in yeast to be a nuclear protein involved in bud-site selection. It plays a role in positioning the proximal bud pole signal []. 
Probab=71.32  E-value=3.5  Score=34.53  Aligned_cols=9  Identities=22%  Similarity=0.110  Sum_probs=3.6

Q ss_pred             HHHHHHHHH
Q 042177           11 LMNLFLLVL   19 (123)
Q Consensus        11 lmnlfllvl   19 (123)
                      +|+-|..+|
T Consensus       137 ~~~~~~~~l  145 (432)
T PF09073_consen  137 IEEGLRQVL  145 (432)
T ss_pred             HHHHHHHHh
Confidence            344444444


No 11 
>PHA02664 hypothetical protein; Provisional
Probab=70.28  E-value=3.5  Score=37.06  Aligned_cols=6  Identities=83%  Similarity=1.159  Sum_probs=2.6

Q ss_pred             cccccc
Q 042177           64 SPHAAP   69 (123)
Q Consensus        64 ~~~A~P   69 (123)
                      +|.|+|
T Consensus       404 sp~aa~  409 (534)
T PHA02664        404 SPMAAP  409 (534)
T ss_pred             CcccCh
Confidence            444444


No 12 
>PF10488 PP1c_bdg:  Phosphatase-1 catalytic subunit binding region;  InterPro: IPR019523  This entry represents the conserved C terminus of the regulatory subunit (15A and 15B) of protein phosphatase 1. This C-terminal domain appears to be a binding region for the catalytic subunit (PP1C) of protein phosphatase-1, which may in some circumstances also be retroviral in origin since it is found in both herpes simplex virus and in mouse and man. This domain is found in Gadd-34 apoptosis-associated proteins as well as the constitutive repressor of eIF2-alpha phosphorylation/protein phosphatase 1, regulatory (inhibitor) subunit 15b, otherwise known as CReP. Diverse stressful conditions are associated with phosphorylation of the alpha-subunit of eukaryotic translation initiation factor 2 (eIF2-alpha) on serine 51. This signaling event, which is conserved from yeast to mammals, negatively regulates the guanine nucleotide exchange factor, eIF2-B and inhibits the recycling of eIF2 to its active GTP bound form. In mammalian cells eIF2-alpha phosphorylation emerges as an important event in stress signaling that impacts on gene expression at both the translational and transcriptional levels []. 
Probab=68.02  E-value=3.1  Score=35.36  Aligned_cols=20  Identities=20%  Similarity=0.130  Sum_probs=8.3

Q ss_pred             hhccccccccccCCCCCCCC
Q 042177           73 ATVNYATCKLYNNCTSTPES   92 (123)
Q Consensus        73 ~~~~yskgK~~~dSdSd~eS   92 (123)
                      -|+-|+.-....-+++++++
T Consensus        17 ~i~g~~~s~~~~ss~~~~~~   36 (307)
T PF10488_consen   17 YILGGASSDLESSSDSEGED   36 (307)
T ss_pred             cccccCccccccccccCccc
Confidence            34444333333334444443


No 13 
>KOG1834 consensus Calsyntenin [Extracellular structures]
Probab=67.42  E-value=3.2  Score=39.73  Aligned_cols=13  Identities=23%  Similarity=0.238  Sum_probs=6.2

Q ss_pred             hhhhccccccccc
Q 042177           71 VNATVNYATCKLY   83 (123)
Q Consensus        71 ~N~~~~yskgK~~   83 (123)
                      ||-.=.|.++.-.
T Consensus       881 VNPme~~e~~gs~  893 (952)
T KOG1834|consen  881 VNPMEDYEKGGSI  893 (952)
T ss_pred             ecchHhcccCCcc
Confidence            4444455554433


No 14 
>KOG4264 consensus Nucleo-cytoplasmic protein MLN51 [General function prediction only]
Probab=61.09  E-value=7.7  Score=36.24  Aligned_cols=21  Identities=14%  Similarity=0.148  Sum_probs=8.9

Q ss_pred             ccccccchhhhhc---cccccccc
Q 042177           63 LSPHAAPLVNATV---NYATCKLY   83 (123)
Q Consensus        63 ~~~~A~Pi~N~~~---~yskgK~~   83 (123)
                      +||---|--|+.+   +|+.++..
T Consensus        45 slp~Q~p~~tgalHlrrvesa~~~   68 (694)
T KOG4264|consen   45 SLPAQNPPQTGALHLRRVESAKPA   68 (694)
T ss_pred             cCcccCCCccCccchhcccccCcc
Confidence            4444444444433   34444443


No 15 
>KOG2925 consensus Predicted translation initiation factor related to eIF-1A [Translation, ribosomal structure and biogenesis]
Probab=57.04  E-value=9.6  Score=30.42  Aligned_cols=11  Identities=64%  Similarity=0.658  Sum_probs=4.2

Q ss_pred             CCCCCCCCCCC
Q 042177           91 ESESESEPDPD  101 (123)
Q Consensus        91 eSdSESEseSD  101 (123)
                      .|+||||+|+|
T Consensus       129 ls~sese~ddd  139 (167)
T KOG2925|consen  129 LSDSESEDDDD  139 (167)
T ss_pred             CCCcccccccC
Confidence            33333333333


No 16 
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=56.97  E-value=7.5  Score=38.72  Aligned_cols=18  Identities=17%  Similarity=0.200  Sum_probs=7.8

Q ss_pred             cccccccc-CCCCCCCCCC
Q 042177           77 YATCKLYN-NCTSTPESES   94 (123)
Q Consensus        77 yskgK~~~-dSdSd~eSdS   94 (123)
                      |+-|+... ++|+|+|.|.
T Consensus      1395 yEIGR~r~~~dd~DeeeD~ 1413 (1516)
T KOG1832|consen 1395 YEIGRRRPTDDDSDEEEDD 1413 (1516)
T ss_pred             hhhcccCCCccccCccccc
Confidence            34455443 3344444433


No 17 
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]
Probab=55.20  E-value=3.9  Score=36.77  Aligned_cols=24  Identities=21%  Similarity=0.373  Sum_probs=20.4

Q ss_pred             ccchhhhcccccccccchhhhhcc
Q 042177           53 AGLGLIGNALLSPHAAPLVNATVN   76 (123)
Q Consensus        53 aglgligna~~~~~A~Pi~N~~~~   76 (123)
                      .|+.=-|..||.+||+|||+..+.
T Consensus       102 IglAeTGSGKT~afaLPIl~~LL~  125 (476)
T KOG0330|consen  102 IGLAETGSGKTGAFALPILQRLLQ  125 (476)
T ss_pred             EEEeccCCCchhhhHHHHHHHHHc
Confidence            356667888999999999999886


No 18 
>KOG1425 consensus Microfibrillar-associated protein MFAP1 [Cytoskeleton]
Probab=54.42  E-value=5.8  Score=35.36  Aligned_cols=13  Identities=46%  Similarity=0.716  Sum_probs=5.4

Q ss_pred             ccccccccccCCC
Q 042177          107 ETESESESESESE  119 (123)
Q Consensus       107 ESdseSdSesDSE  119 (123)
                      +++.++||++|.+
T Consensus       170 e~ee~tdsEdD~~  182 (430)
T KOG1425|consen  170 ESEEETDSEDDME  182 (430)
T ss_pred             ccccccccccccc
Confidence            3334444444443


No 19 
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=53.36  E-value=10  Score=39.36  Aligned_cols=6  Identities=0%  Similarity=-0.230  Sum_probs=2.3

Q ss_pred             cccccc
Q 042177           76 NYATCK   81 (123)
Q Consensus        76 ~yskgK   81 (123)
                      ++-.|.
T Consensus      1724 egq~~e 1729 (3015)
T KOG0943|consen 1724 EGQEGE 1729 (3015)
T ss_pred             cCCccc
Confidence            333343


No 20 
>PF14998 Ripply:  Transcription Regulator
Probab=52.03  E-value=7.2  Score=28.01  Aligned_cols=14  Identities=36%  Similarity=0.534  Sum_probs=8.6

Q ss_pred             cccccccCCCCCCC
Q 042177           78 ATCKLYNNCTSTPE   91 (123)
Q Consensus        78 skgK~~~dSdSd~e   91 (123)
                      +|..|++|||||+|
T Consensus        72 ATI~fY~Dsdsede   85 (87)
T PF14998_consen   72 ATIHFYEDSDSEDE   85 (87)
T ss_pred             eEEEeccCCCcccc
Confidence            67778875544443


No 21 
>KOG2141 consensus Protein involved in high osmolarity signaling pathway [Signal transduction mechanisms]
Probab=51.90  E-value=9.9  Score=36.25  Aligned_cols=9  Identities=44%  Similarity=0.696  Sum_probs=3.7

Q ss_pred             ccCcccccc
Q 042177           34 FKQPQVRDQ   42 (123)
Q Consensus        34 fkqpqvrdq   42 (123)
                      |+-|.|-++
T Consensus       177 ~~~~~~l~~  185 (822)
T KOG2141|consen  177 LKLPKVLDS  185 (822)
T ss_pred             cccchhhhh
Confidence            344444433


No 22 
>PF01056 Myc_N:  Myc amino-terminal region;  InterPro: IPR012682 The class III basic helix-turn-helix (bHLH) transcription factors have proliferative and apoptotic roles and are characterised by the presence of a leucine zipper adjacent to the bHLH domain. The myc oncogene gene was first discovered in small-cell lung cancer cell lines where it is found to be deregulated []. Although the biochemical function of the gene product is unknown, as a nuclear protein with a short half-life it may play a direct or indirect role in controlling gene expression []. Myc forms a heterodimer with Max, and this complex regulates cell growth through direct activation of genes involved in cell replication []. This entry represents the N-terminal domain found adjacent to the basic helix-loop-helix (bHLH) region (IPR001092 from INTERPRO).; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1EE4_C.
Probab=49.35  E-value=5.6  Score=33.52  Aligned_cols=15  Identities=47%  Similarity=0.499  Sum_probs=0.0

Q ss_pred             cccccccccCCCCCC
Q 042177          108 TESESESESESEPDN  122 (123)
Q Consensus       108 SdseSdSesDSEsd~  122 (123)
                      ++++.++++++|=||
T Consensus       232 ~~~~eeeeeeEEIDV  246 (329)
T PF01056_consen  232 EEEEEEEEEEEEIDV  246 (329)
T ss_dssp             ---------------
T ss_pred             cccccccCCCcceEE
Confidence            333334444455444


No 23 
>KOG2140 consensus Uncharacterized conserved protein [General function prediction only]
Probab=43.06  E-value=15  Score=34.64  Aligned_cols=11  Identities=18%  Similarity=0.422  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHH
Q 042177            5 TKMFNVLMNLF   15 (123)
Q Consensus         5 tkmfnvlmnlf   15 (123)
                      .-||+-|.+-+
T Consensus       583 KilFqELve~l  593 (739)
T KOG2140|consen  583 KILFQELVEAL  593 (739)
T ss_pred             HHHHHHHHHHh
Confidence            34566555543


No 24 
>KOG2140 consensus Uncharacterized conserved protein [General function prediction only]
Probab=39.02  E-value=20  Score=33.79  Aligned_cols=16  Identities=6%  Similarity=0.044  Sum_probs=7.7

Q ss_pred             hcccccccccchhhhh
Q 042177           59 GNALLSPHAAPLVNAT   74 (123)
Q Consensus        59 gna~~~~~A~Pi~N~~   74 (123)
                      -|+.-.-|+|-.+-+|
T Consensus       618 dnp~n~RfsINfFTsI  633 (739)
T KOG2140|consen  618 DNPRNTRFSINFFTSI  633 (739)
T ss_pred             CCcccceeeeehhhhh
Confidence            3555555555544443


No 25 
>PRK09993 C-lysozyme inhibitor; Provisional
Probab=32.21  E-value=31  Score=26.95  Aligned_cols=49  Identities=27%  Similarity=0.331  Sum_probs=34.1

Q ss_pred             hHHHHHHHHHHHHHHHhhc--cCCCCCCCcccccCccccc------cccccchhheecc
Q 042177            4 ITKMFNVLMNLFLLVLASN--AQGHNSNDEDIFKQPQVRD------QGERGVSKVVTAG   54 (123)
Q Consensus         4 itkmfnvlmnlfllvlasn--aqghnsndedifkqpqvrd------qgergvskvvtag   54 (123)
                      ++.||..|+.++||+.+..  ||+- ..--++.+||..|.      +|+| +-+-|+-|
T Consensus         3 ~~~~~~~l~aa~lL~~s~~a~Aq~d-~t~seLl~~p~yk~aw~~mvkg~~-LP~WV~~g   59 (153)
T PRK09993          3 GGMMFKALTTVAALVIATSAMAQDD-LTISSLAKGETTKAAFNQMVQGHK-LPAWVMKG   59 (153)
T ss_pred             cchHHHHHHHHHHHHHHHHHHhcCC-ccHHHHhcCHHHHHHHHHHHcCCC-CcHHHHcC
Confidence            5789999999999886543  4443 33446668998875      5665 66666665


No 26 
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=30.32  E-value=34  Score=32.17  Aligned_cols=8  Identities=25%  Similarity=0.136  Sum_probs=3.1

Q ss_pred             CCcccccC
Q 042177           29 NDEDIFKQ   36 (123)
Q Consensus        29 ndedifkq   36 (123)
                      +-+-+++|
T Consensus        98 ~veK~~~q  105 (678)
T KOG0127|consen   98 AVEKPIEQ  105 (678)
T ss_pred             hhhccccc
Confidence            33333433


No 27 
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=29.59  E-value=41  Score=35.33  Aligned_cols=13  Identities=0%  Similarity=-0.171  Sum_probs=6.4

Q ss_pred             hhccccccccccC
Q 042177           73 ATVNYATCKLYNN   85 (123)
Q Consensus        73 ~~~~yskgK~~~d   85 (123)
                      +-+.|+.-..+++
T Consensus      1728 ~ef~GEed~~Ddd 1740 (3015)
T KOG0943|consen 1728 GEFAGEEDHHDDD 1740 (3015)
T ss_pred             ccccCcccccccc
Confidence            3455655554443


No 28 
>PF08706 D5_N:  D5 N terminal like;  InterPro: IPR014818 This domain is found in D5 proteins of DNA viruses and bacteriophage P4 DNA primase. 
Probab=29.29  E-value=21  Score=23.36  Aligned_cols=22  Identities=18%  Similarity=0.247  Sum_probs=18.7

Q ss_pred             ccccccchhhhhcccccccccc
Q 042177           63 LSPHAAPLVNATVNYATCKLYN   84 (123)
Q Consensus        63 ~~~~A~Pi~N~~~~yskgK~~~   84 (123)
                      .-|+.||.-||+++-.+|++..
T Consensus        96 ~~~~~i~~~NGvldl~tg~l~~  117 (150)
T PF08706_consen   96 ADPNLINFKNGVLDLRTGELRP  117 (150)
T ss_pred             CCcCEEecCCEEEECCCCeecC
Confidence            3478999999999999999754


No 29 
>PF00981 Rota_NS53:  Rotavirus RNA-binding Protein 53 (NS53);  InterPro: IPR002148 The proteins in this entry are variously described as either non-structural protein 1 (NSP1) or non-structural RNA-binding protein 53(NS53). They are RNA binding proteins that contain a characteristic cysteine rich region [, ]. They are made at low levels in infected cells and are a component of early replication and are known to accumulate on the cytoskeleton of the infected cell.; GO: 0003723 RNA binding
Probab=28.89  E-value=50  Score=30.10  Aligned_cols=34  Identities=35%  Similarity=0.629  Sum_probs=29.0

Q ss_pred             chhHHHHHHHHHHHHHHHhhcc-CCCCCCCccccc
Q 042177            2 VRITKMFNVLMNLFLLVLASNA-QGHNSNDEDIFK   35 (123)
Q Consensus         2 vritkmfnvlmnlfllvlasna-qghnsndedifk   35 (123)
                      .||.||+|-+|++.=...-||. -||-|.-|.|.+
T Consensus       336 fRi~~iYn~im~Firal~KSN~nvgHCSS~E~iY~  370 (488)
T PF00981_consen  336 FRIKKIYNNIMSFIRALVKSNVNVGHCSSQESIYP  370 (488)
T ss_pred             HhHHHHHHHHHHHHHHHHhcCCCccccccHHHHHH
Confidence            4899999999999888888886 599999887753


No 30 
>PF09849 DUF2076:  Uncharacterized protein conserved in bacteria (DUF2076);  InterPro: IPR018648  This family of hypothetical prokaryotic proteins has no known function but includes putative perimplasmic ligand-binding sensor proteins.
Probab=28.43  E-value=2.3e+02  Score=23.01  Aligned_cols=9  Identities=33%  Similarity=0.508  Sum_probs=6.7

Q ss_pred             HHHHHHHHH
Q 042177            7 MFNVLMNLF   15 (123)
Q Consensus         7 mfnvlmnlf   15 (123)
                      +||.|+|||
T Consensus       154 L~n~i~~lF  162 (247)
T PF09849_consen  154 LANGIESLF  162 (247)
T ss_pred             HHHHHHHHh
Confidence            577777777


No 31 
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=27.77  E-value=49  Score=31.71  Aligned_cols=20  Identities=20%  Similarity=-0.077  Sum_probs=11.9

Q ss_pred             hhcccccccc---cchhhhhccc
Q 042177           58 IGNALLSPHA---APLVNATVNY   77 (123)
Q Consensus        58 igna~~~~~A---~Pi~N~~~~y   77 (123)
                      -+-|+++-|+   -|-+-||.+-
T Consensus       478 ~mKaKlLqF~~NrRP~YyGTWrK  500 (811)
T KOG4364|consen  478 RMKAKLLQFDKNRRPGYYGTWRK  500 (811)
T ss_pred             hhHHHHhhhccccCCcccccccc
Confidence            3667777765   3555566543


No 32 
>KOG3540 consensus Beta amyloid precursor protein [General function prediction only]
Probab=27.18  E-value=59  Score=30.31  Aligned_cols=24  Identities=21%  Similarity=0.288  Sum_probs=17.0

Q ss_pred             eeccchhhhcccccccccchhhhh
Q 042177           51 VTAGLGLIGNALLSPHAAPLVNAT   74 (123)
Q Consensus        51 vtaglgligna~~~~~A~Pi~N~~   74 (123)
                      -|-|+-|-+-+.++|-++-.+-|+
T Consensus       161 ~tk~mil~~~gmLlPCg~D~F~Gv  184 (615)
T KOG3540|consen  161 STKGMILHSYGMLLPCGLDMFRGV  184 (615)
T ss_pred             ccCCeeeecccceeccccccccCc
Confidence            345777778888899887666553


No 33 
>KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis]
Probab=25.19  E-value=31  Score=33.14  Aligned_cols=6  Identities=50%  Similarity=0.457  Sum_probs=2.1

Q ss_pred             CCCCCC
Q 042177           87 TSTPES   92 (123)
Q Consensus        87 dSd~eS   92 (123)
                      +|+++|
T Consensus        10 ese~es   15 (843)
T KOG1076|consen   10 ESESES   15 (843)
T ss_pred             cccccc
Confidence            333333


No 34 
>COG5058 LAG1 Protein transporter of the TRAM (translocating chain-associating membrane) superfamily, longevity assurance factor [Intracellular trafficking and secretion]
Probab=24.69  E-value=40  Score=29.97  Aligned_cols=6  Identities=33%  Similarity=0.490  Sum_probs=2.6

Q ss_pred             HHHHHH
Q 042177            5 TKMFNV   10 (123)
Q Consensus         5 tkmfnv   10 (123)
                      .||.|.
T Consensus       276 sK~lnY  281 (395)
T COG5058         276 SKTLNY  281 (395)
T ss_pred             HHHHHH
Confidence            444443


No 35 
>PF08453 Peptidase_M9_N:  Peptidase family M9 N-terminal;  InterPro: IPR013661 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This domain is found in microbial collagenase metalloproteases to the N terminus of IPR013510 from INTERPRO. Proteins containing this domain belong tp MEROPS peptidase family M9, subfamilies M9A and M9B (microbial collagenase, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. Microbial collagenases have been identified from bacteria of both the Vibrio and Clostridium genuses. Collagenase is used during bacterial attack to degrade the collagen barrier of the host during invasion. Vibrio bacteria are non-pathogenic, and are sometimes used in hospitals to remove dead tissue from burns and ulcers. Clostridium histolyticum is a pathogen that causes gas gangrene; nevertheless, the isolated collagenase has been used to treat bed sores. Collagen cleavage occurs at an Xaa+Gly in Vibrio bacteria and at Yaa+Gly bonds in Clostridium collagenases. Analysis of the primary structure of the gene product from Clostridium perfringens has revealed that the enzyme is produced with a stretch of 86 residues that contain a putative signal sequence []. Within this stretch is found PLGP, an amino acid sequence typical of collagenase substrates. This sequence may thus be implicated in self-processing of the collagenase [].; GO: 0004252 serine-type endopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 2Y3U_A 2Y6I_A 2Y50_A.
Probab=24.26  E-value=12  Score=28.35  Aligned_cols=45  Identities=24%  Similarity=0.234  Sum_probs=32.0

Q ss_pred             ccccCccccccccccchhheeccchhhhcccccccccchhhhhccc
Q 042177           32 DIFKQPQVRDQGERGVSKVVTAGLGLIGNALLSPHAAPLVNATVNY   77 (123)
Q Consensus        32 difkqpqvrdqgergvskvvtaglgligna~~~~~A~Pi~N~~~~y   77 (123)
                      .+++.|-..+++ +.--+|+..-+-||+|++..|..+|.+-.+|+.
T Consensus       105 af~~np~~~~~t-~~q~~vl~e~~~lids~~~~~~~l~~~~~~L~~  149 (190)
T PF08453_consen  105 AFFANPNFFDGT-DEQGKVLKELGILIDSAKQNAEYLPVVKQILNQ  149 (190)
T ss_dssp             HHHHSTTGSS-S-HHHHHHHHHHHHHHHHS---HHHHHTTHHHHHH
T ss_pred             HHHhCchhhhcc-hhHHHHHHHHHHHhcCCcccHHHHHHHHHHHHH
Confidence            357778888855 445578888888999999999999988877764


No 36 
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]
Probab=23.77  E-value=57  Score=29.31  Aligned_cols=7  Identities=29%  Similarity=0.672  Sum_probs=2.7

Q ss_pred             ccccccc
Q 042177          107 ETESESE  113 (123)
Q Consensus       107 ESdseSd  113 (123)
                      |.|+|++
T Consensus       418 edded~~  424 (434)
T KOG3555|consen  418 EDDEDSD  424 (434)
T ss_pred             ccccccc
Confidence            3333333


No 37 
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning]
Probab=23.69  E-value=64  Score=29.62  Aligned_cols=11  Identities=18%  Similarity=0.153  Sum_probs=5.6

Q ss_pred             chhhhhccccc
Q 042177           69 PLVNATVNYAT   79 (123)
Q Consensus        69 Pi~N~~~~ysk   79 (123)
                      -+++.++.+-+
T Consensus       420 ~~~~~~~t~l~  430 (520)
T KOG2270|consen  420 NLLYTTITGLD  430 (520)
T ss_pred             cchhhhhhccc
Confidence            34555555543


No 38 
>KOG2959 consensus Transcriptional regulator [Transcription]
Probab=23.63  E-value=58  Score=27.26  Aligned_cols=31  Identities=32%  Similarity=0.424  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCcccccccccccccCCC
Q 042177           88 STPESESESEPDPDAESESETESESESESESE  119 (123)
Q Consensus        88 Sd~eSdSESEseSDSESeSESdseSdSesDSE  119 (123)
                      ||.+++---.+++.+||+++.++.|+ .++||
T Consensus        48 ~De~~~~~~~~~~~EE~~~~d~~~S~-n~~SE   78 (238)
T KOG2959|consen   48 SDEDEDRAAASSSEEESSSGDESNSS-NSQSE   78 (238)
T ss_pred             cccccccccccccccccccccccccc-ccccc


No 39 
>KOG2652 consensus RNA polymerase II transcription initiation factor TFIIA, large chain [Transcription]
Probab=23.16  E-value=72  Score=27.88  Aligned_cols=8  Identities=13%  Similarity=0.235  Sum_probs=3.4

Q ss_pred             cchhhhhc
Q 042177           68 APLVNATV   75 (123)
Q Consensus        68 ~Pi~N~~~   75 (123)
                      |+.+.+-+
T Consensus       240 i~qv~~~~  247 (348)
T KOG2652|consen  240 IAQVDLSL  247 (348)
T ss_pred             hhhhcccc
Confidence            44444433


No 40 
>KOG0262 consensus RNA polymerase I, large subunit [Transcription]
Probab=22.80  E-value=66  Score=33.02  Aligned_cols=14  Identities=36%  Similarity=0.477  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHHHh
Q 042177            7 MFNVLMNLFLLVLA   20 (123)
Q Consensus         7 mfnvlmnlfllvla   20 (123)
                      ..+++-|-||..|.
T Consensus      1281 i~~~m~~~Flk~L~ 1294 (1640)
T KOG0262|consen 1281 IEEVMENRFLKLLE 1294 (1640)
T ss_pred             HHHHHHHHHHHHHH
Confidence            34555555655553


No 41 
>KOG0347 consensus RNA helicase [RNA processing and modification]
Probab=22.80  E-value=31  Score=32.66  Aligned_cols=20  Identities=20%  Similarity=0.308  Sum_probs=16.3

Q ss_pred             ccchhhhcccccccccchhh
Q 042177           53 AGLGLIGNALLSPHAAPLVN   72 (123)
Q Consensus        53 aglgligna~~~~~A~Pi~N   72 (123)
                      .|..=-|..||+||+||||-
T Consensus       223 lGaAeTGSGKTLAFGIPiv~  242 (731)
T KOG0347|consen  223 LGAAETGSGKTLAFGIPIVE  242 (731)
T ss_pred             ccccccCCCceeeecchhhh
Confidence            45556678899999999997


No 42 
>PF08401 DUF1738:  Domain of unknown function (DUF1738);  InterPro: IPR013610 This region is found in a number of bacterial hypothetical proteins. Some members are annotated as being similar to replication primases, and in fact this region is often found together with the Toprim domain (IPR006171 from INTERPRO). 
Probab=22.78  E-value=40  Score=23.73  Aligned_cols=28  Identities=32%  Similarity=0.341  Sum_probs=23.3

Q ss_pred             HHHHHHHHHhhccCCCCCCCcccccCcc
Q 042177           11 LMNLFLLVLASNAQGHNSNDEDIFKQPQ   38 (123)
Q Consensus        11 lmnlfllvlasnaqghnsndedifkqpq   38 (123)
                      -+|.++|.++...+|+.++-=--|+|-+
T Consensus        48 G~N~l~L~~~~~~~gy~~prw~Tf~Qak   75 (125)
T PF08401_consen   48 GINALLLWLAAEENGYKDPRWMTFKQAK   75 (125)
T ss_pred             eehHHHHHHHHHHcCCCCCcEEcHHHHH
Confidence            3789999999999999988877777654


No 43 
>KOG3228 consensus Uncharacterized conserved protein [Function unknown]
Probab=21.64  E-value=45  Score=27.76  Aligned_cols=7  Identities=43%  Similarity=0.838  Sum_probs=2.8

Q ss_pred             ccccccc
Q 042177          107 ETESESE  113 (123)
Q Consensus       107 ESdseSd  113 (123)
                      ++++|||
T Consensus       118 d~d~esD  124 (226)
T KOG3228|consen  118 DSDSESD  124 (226)
T ss_pred             ccccccc
Confidence            3333444


No 44 
>PF03419 Peptidase_U4:  Sporulation factor SpoIIGA  This family belongs to family U4 of the peptidase classification.;  InterPro: IPR005081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.   The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported. This group of peptidases belong to the MEROPS peptidase family U4 (SpoIIGA peptidase family, clan U-).  Sporulation in bacteria such as Bacillus subtilis involves the formation of a polar septum, which divides the sporangium into a mother cell and a forespore. The sigma E factor, which is encoded within the spoIIG operon, is a cell-specific regulatory protein that directs gene transcription in the mother cell. Sigma E is synthesised as an inactive proprotein pro-sigma E, which is converted to the mature factor by the putative processing enzyme SpoIIGA []. ; GO: 0004190 aspartic-type endopeptidase activity, 0006508 proteolysis, 0030436 asexual sporulation
Probab=21.61  E-value=81  Score=24.64  Aligned_cols=22  Identities=32%  Similarity=0.446  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHhhccCCCC
Q 042177            6 KMFNVLMNLFLLVLASNAQGHN   27 (123)
Q Consensus         6 kmfnvlmnlfllvlasnaqghn   27 (123)
                      =+.|.+||+++|.++.-..+..
T Consensus         9 fl~N~~md~~lL~~t~~~~~~~   30 (293)
T PF03419_consen    9 FLVNFLMDYFLLWLTARLLKRR   30 (293)
T ss_pred             HHHHHHHHHHHHHHHHHHhcCC
Confidence            4579999999999987655443


No 45 
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]
Probab=21.54  E-value=59  Score=30.62  Aligned_cols=42  Identities=26%  Similarity=0.480  Sum_probs=29.9

Q ss_pred             cCccccccccccchhheeccchhhhcccc-----------cccccchhhhhcc
Q 042177           35 KQPQVRDQGERGVSKVVTAGLGLIGNALL-----------SPHAAPLVNATVN   76 (123)
Q Consensus        35 kqpqvrdqgergvskvvtaglgligna~~-----------~~~A~Pi~N~~~~   76 (123)
                      +||--++--|.|+-++-..++|..|+.-.           .|.+-|+.|...|
T Consensus       424 ~~p~~eesdee~~~~~~l~siG~~G~gyi~~~~~~~dee~~~~~~~~~~~k~n  476 (673)
T KOG1461|consen  424 RQPTTEESDEEGLDDVKLKSIGPDGAGYIWETEDADDEEWKPLVPPSPNDKTN  476 (673)
T ss_pred             cCCcccccchhhccchheeeccCCcceeeecccCcccccccccccCCcccccc
Confidence            56666666666777777778888887643           3567788888777


No 46 
>KOG2147 consensus Nucleolar protein involved in 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]
Probab=20.82  E-value=72  Score=30.72  Aligned_cols=13  Identities=15%  Similarity=0.153  Sum_probs=6.8

Q ss_pred             hccccccccccCC
Q 042177           74 TVNYATCKLYNNC   86 (123)
Q Consensus        74 ~~~yskgK~~~dS   86 (123)
                      -+-+..|++-...
T Consensus       312 ~~~~ddgk~l~~E  324 (823)
T KOG2147|consen  312 EVDFDDGKGLEEE  324 (823)
T ss_pred             ccccccccccccc
Confidence            3445666655433


No 47 
>PHA03151 hypothetical protein; Provisional
Probab=20.21  E-value=85  Score=26.54  Aligned_cols=11  Identities=36%  Similarity=0.661  Sum_probs=5.7

Q ss_pred             cccCccccccc
Q 042177           33 IFKQPQVRDQG   43 (123)
Q Consensus        33 ifkqpqvrdqg   43 (123)
                      .||-|.-.+.+
T Consensus        35 yFkFPp~~~~~   45 (259)
T PHA03151         35 VFKFPTDEDDS   45 (259)
T ss_pred             eeeCCCCcccC
Confidence            46666554443


No 48 
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]
Probab=20.20  E-value=37  Score=30.54  Aligned_cols=18  Identities=22%  Similarity=0.344  Sum_probs=13.3

Q ss_pred             hhhcccccccccchhhhh
Q 042177           57 LIGNALLSPHAAPLVNAT   74 (123)
Q Consensus        57 ligna~~~~~A~Pi~N~~   74 (123)
                      --|..||.+||+||+|-.
T Consensus        52 kTGsGKT~AFaLPil~rL   69 (442)
T KOG0340|consen   52 KTGSGKTAAFALPILNRL   69 (442)
T ss_pred             ccCCCcchhhhHHHHHhh
Confidence            344556789999999853


No 49 
>TIGR02854 spore_II_GA sigma-E processing peptidase SpoIIGA. Members of this protein family are the stage II sporulation protein SpoIIGA. This protein acts as an activating protease for Sigma-E, one of several specialized sigma factors of the sporulation process in Bacillus subtilis and related endospore-forming bacteria.
Probab=20.15  E-value=89  Score=24.95  Aligned_cols=20  Identities=25%  Similarity=0.414  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHhhccCC
Q 042177            6 KMFNVLMNLFLLVLASNAQG   25 (123)
Q Consensus         6 kmfnvlmnlfllvlasnaqg   25 (123)
                      =+.|.+||.|||.++.-.-+
T Consensus         9 ~l~Nf~~d~~LL~~t~~~lk   28 (288)
T TIGR02854         9 FLENFIIDYFLLYLTARTLK   28 (288)
T ss_pred             HHHHHHHHHHHHHHHHHHhh
Confidence            46799999999998875443


Done!