Query 042177
Match_columns 123
No_of_seqs 15 out of 17
Neff 1.5
Searched_HMMs 46136
Date Fri Mar 29 03:34:11 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042177.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042177hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 COG5129 MAK16 Nuclear protein 93.4 0.035 7.7E-07 46.9 1.2 10 3-12 110-119 (303)
2 KOG1189 Global transcriptional 92.0 0.096 2.1E-06 49.7 2.1 18 30-48 739-756 (960)
3 PF09026 CENP-B_dimeris: Centr 90.4 0.081 1.8E-06 39.1 0.0 9 93-101 11-19 (101)
4 KOG3064 RNA-binding nuclear pr 88.1 0.15 3.2E-06 43.5 -0.1 17 3-19 111-127 (303)
5 KOG2236 Uncharacterized conser 86.5 0.8 1.7E-05 41.0 3.6 9 69-77 91-99 (483)
6 PTZ00007 (NAP-L) nucleosome as 83.9 1 2.2E-05 37.9 2.9 12 109-120 307-318 (337)
7 PF02724 CDC45: CDC45-like pro 78.3 1.7 3.8E-05 38.3 2.5 7 50-56 55-61 (622)
8 KOG1060 Vesicle coat complex A 77.5 2.2 4.7E-05 41.0 3.1 8 3-10 563-570 (968)
9 PF05285 SDA1: SDA1; InterPro 73.0 2.3 5.1E-05 34.5 1.8 8 11-18 27-34 (324)
10 PF09073 BUD22: BUD22; InterP 71.3 3.5 7.6E-05 34.5 2.5 9 11-19 137-145 (432)
11 PHA02664 hypothetical protein; 70.3 3.5 7.5E-05 37.1 2.4 6 64-69 404-409 (534)
12 PF10488 PP1c_bdg: Phosphatase 68.0 3.1 6.8E-05 35.4 1.6 20 73-92 17-36 (307)
13 KOG1834 Calsyntenin [Extracell 67.4 3.2 6.9E-05 39.7 1.6 13 71-83 881-893 (952)
14 KOG4264 Nucleo-cytoplasmic pro 61.1 7.7 0.00017 36.2 2.8 21 63-83 45-68 (694)
15 KOG2925 Predicted translation 57.0 9.6 0.00021 30.4 2.4 11 91-101 129-139 (167)
16 KOG1832 HIV-1 Vpr-binding prot 57.0 7.5 0.00016 38.7 2.1 18 77-94 1395-1413(1516)
17 KOG0330 ATP-dependent RNA heli 55.2 3.9 8.6E-05 36.8 -0.0 24 53-76 102-125 (476)
18 KOG1425 Microfibrillar-associa 54.4 5.8 0.00013 35.4 0.9 13 107-119 170-182 (430)
19 KOG0943 Predicted ubiquitin-pr 53.4 10 0.00022 39.4 2.5 6 76-81 1724-1729(3015)
20 PF14998 Ripply: Transcription 52.0 7.2 0.00016 28.0 0.9 14 78-91 72-85 (87)
21 KOG2141 Protein involved in hi 51.9 9.9 0.00021 36.2 2.0 9 34-42 177-185 (822)
22 PF01056 Myc_N: Myc amino-term 49.4 5.6 0.00012 33.5 0.0 15 108-122 232-246 (329)
23 KOG2140 Uncharacterized conser 43.1 15 0.00032 34.6 1.7 11 5-15 583-593 (739)
24 KOG2140 Uncharacterized conser 39.0 20 0.00044 33.8 1.9 16 59-74 618-633 (739)
25 PRK09993 C-lysozyme inhibitor; 32.2 31 0.00067 26.9 1.7 49 4-54 3-59 (153)
26 KOG0127 Nucleolar protein fibr 30.3 34 0.00074 32.2 1.9 8 29-36 98-105 (678)
27 KOG0943 Predicted ubiquitin-pr 29.6 41 0.00089 35.3 2.4 13 73-85 1728-1740(3015)
28 PF08706 D5_N: D5 N terminal l 29.3 21 0.00045 23.4 0.3 22 63-84 96-117 (150)
29 PF00981 Rota_NS53: Rotavirus 28.9 50 0.0011 30.1 2.6 34 2-35 336-370 (488)
30 PF09849 DUF2076: Uncharacteri 28.4 2.3E+02 0.005 23.0 6.1 9 7-15 154-162 (247)
31 KOG4364 Chromatin assembly fac 27.8 49 0.0011 31.7 2.5 20 58-77 478-500 (811)
32 KOG3540 Beta amyloid precursor 27.2 59 0.0013 30.3 2.8 24 51-74 161-184 (615)
33 KOG1076 Translation initiation 25.2 31 0.00068 33.1 0.8 6 87-92 10-15 (843)
34 COG5058 LAG1 Protein transport 24.7 40 0.00086 30.0 1.3 6 5-10 276-281 (395)
35 PF08453 Peptidase_M9_N: Pepti 24.3 12 0.00025 28.3 -1.8 45 32-77 105-149 (190)
36 KOG3555 Ca2+-binding proteogly 23.8 57 0.0012 29.3 2.1 7 107-113 418-424 (434)
37 KOG2270 Serine/threonine prote 23.7 64 0.0014 29.6 2.4 11 69-79 420-430 (520)
38 KOG2959 Transcriptional regula 23.6 58 0.0013 27.3 2.0 31 88-119 48-78 (238)
39 KOG2652 RNA polymerase II tran 23.2 72 0.0016 27.9 2.5 8 68-75 240-247 (348)
40 KOG0262 RNA polymerase I, larg 22.8 66 0.0014 33.0 2.5 14 7-20 1281-1294(1640)
41 KOG0347 RNA helicase [RNA proc 22.8 31 0.00067 32.7 0.3 20 53-72 223-242 (731)
42 PF08401 DUF1738: Domain of un 22.8 40 0.00086 23.7 0.8 28 11-38 48-75 (125)
43 KOG3228 Uncharacterized conser 21.6 45 0.00097 27.8 0.9 7 107-113 118-124 (226)
44 PF03419 Peptidase_U4: Sporula 21.6 81 0.0018 24.6 2.3 22 6-27 9-30 (293)
45 KOG1461 Translation initiation 21.5 59 0.0013 30.6 1.8 42 35-76 424-476 (673)
46 KOG2147 Nucleolar protein invo 20.8 72 0.0016 30.7 2.2 13 74-86 312-324 (823)
47 PHA03151 hypothetical protein; 20.2 85 0.0019 26.5 2.3 11 33-43 35-45 (259)
48 KOG0340 ATP-dependent RNA heli 20.2 37 0.0008 30.5 0.2 18 57-74 52-69 (442)
49 TIGR02854 spore_II_GA sigma-E 20.1 89 0.0019 25.0 2.3 20 6-25 9-28 (288)
No 1
>COG5129 MAK16 Nuclear protein with HMG-like acidic region [General function prediction only]
Probab=93.41 E-value=0.035 Score=46.92 Aligned_cols=10 Identities=40% Similarity=0.673 Sum_probs=5.4
Q ss_pred hhHHHHHHHH
Q 042177 3 RITKMFNVLM 12 (123)
Q Consensus 3 ritkmfnvlm 12 (123)
|+||+-.+|+
T Consensus 110 rltkLTQyll 119 (303)
T COG5129 110 RLTKLTQYLL 119 (303)
T ss_pred HHHHHHHHHH
Confidence 4556555553
No 2
>KOG1189 consensus Global transcriptional regulator, cell division control protein [Amino acid transport and metabolism]
Probab=91.97 E-value=0.096 Score=49.75 Aligned_cols=18 Identities=39% Similarity=0.562 Sum_probs=10.0
Q ss_pred CcccccCccccccccccch
Q 042177 30 DEDIFKQPQVRDQGERGVS 48 (123)
Q Consensus 30 dedifkqpqvrdqgergvs 48 (123)
.+--|++| .|+-|-.||.
T Consensus 739 ~~~efd~p-fr~lGF~GvP 756 (960)
T KOG1189|consen 739 SELEFDVP-FRELGFNGVP 756 (960)
T ss_pred cceeeccc-hhhcCcCCCC
Confidence 34446554 5666666653
No 3
>PF09026 CENP-B_dimeris: Centromere protein B dimerisation domain; InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=90.39 E-value=0.081 Score=39.12 Aligned_cols=9 Identities=56% Similarity=0.841 Sum_probs=0.0
Q ss_pred CCCCCCCCC
Q 042177 93 ESESEPDPD 101 (123)
Q Consensus 93 dSESEseSD 101 (123)
+|++|+|.|
T Consensus 11 dse~dsdEd 19 (101)
T PF09026_consen 11 DSESDSDED 19 (101)
T ss_dssp ---------
T ss_pred ccccccccc
Confidence 333333333
No 4
>KOG3064 consensus RNA-binding nuclear protein (MAK16) containing a distinct C4 Zn-finger [RNA processing and modification]
Probab=88.11 E-value=0.15 Score=43.46 Aligned_cols=17 Identities=35% Similarity=0.507 Sum_probs=10.0
Q ss_pred hhHHHHHHHHHHHHHHH
Q 042177 3 RITKMFNVLMNLFLLVL 19 (123)
Q Consensus 3 ritkmfnvlmnlfllvl 19 (123)
|+|||-.+|.-+=-|.|
T Consensus 111 RltklTQylir~rklal 127 (303)
T KOG3064|consen 111 RLTKLTQYLIRMRKLAL 127 (303)
T ss_pred HHHHHHHHHHHHHHHHh
Confidence 56777666665544443
No 5
>KOG2236 consensus Uncharacterized conserved protein [Function unknown]
Probab=86.53 E-value=0.8 Score=41.03 Aligned_cols=9 Identities=22% Similarity=0.157 Sum_probs=4.1
Q ss_pred chhhhhccc
Q 042177 69 PLVNATVNY 77 (123)
Q Consensus 69 Pi~N~~~~y 77 (123)
++|.-++.|
T Consensus 91 d~vd~~~~g 99 (483)
T KOG2236|consen 91 DLVDPILVG 99 (483)
T ss_pred cccchhhcC
Confidence 344444444
No 6
>PTZ00007 (NAP-L) nucleosome assembly protein -L; Provisional
Probab=83.93 E-value=1 Score=37.89 Aligned_cols=12 Identities=25% Similarity=0.498 Sum_probs=4.6
Q ss_pred ccccccccCCCC
Q 042177 109 ESESESESESEP 120 (123)
Q Consensus 109 dseSdSesDSEs 120 (123)
|++|+++.++++
T Consensus 307 ~~~~~~~~~~~~ 318 (337)
T PTZ00007 307 DSNSDVDTNEED 318 (337)
T ss_pred cccccccccccc
Confidence 333333333333
No 7
>PF02724 CDC45: CDC45-like protein; InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=78.27 E-value=1.7 Score=38.29 Aligned_cols=7 Identities=29% Similarity=0.472 Sum_probs=3.6
Q ss_pred heeccch
Q 042177 50 VVTAGLG 56 (123)
Q Consensus 50 vvtaglg 56 (123)
||..|+|
T Consensus 55 vilIncG 61 (622)
T PF02724_consen 55 VILINCG 61 (622)
T ss_pred EEEEecC
Confidence 5555554
No 8
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport]
Probab=77.51 E-value=2.2 Score=41.05 Aligned_cols=8 Identities=13% Similarity=0.181 Sum_probs=4.2
Q ss_pred hhHHHHHH
Q 042177 3 RITKMFNV 10 (123)
Q Consensus 3 ritkmfnv 10 (123)
|+.||+++
T Consensus 563 RF~r~l~~ 570 (968)
T KOG1060|consen 563 RFLRQLIS 570 (968)
T ss_pred HHHHHHhc
Confidence 55555543
No 9
>PF05285 SDA1: SDA1; InterPro: IPR007949 This domain consists of several SDA1 protein homologues. SDA1 is a Saccharomyces cerevisiae protein which is involved in the control of the actin cytoskeleton. The protein is essential for cell viability and is localised in the nucleus [].
Probab=73.02 E-value=2.3 Score=34.52 Aligned_cols=8 Identities=63% Similarity=0.820 Sum_probs=3.8
Q ss_pred HHHHHHHH
Q 042177 11 LMNLFLLV 18 (123)
Q Consensus 11 lmnlfllv 18 (123)
|+|||==|
T Consensus 27 li~l~Rev 34 (324)
T PF05285_consen 27 LINLFREV 34 (324)
T ss_pred HHHHHHHH
Confidence 45555433
No 10
>PF09073 BUD22: BUD22; InterPro: IPR015158 BUD22 has been shown in yeast to be a nuclear protein involved in bud-site selection. It plays a role in positioning the proximal bud pole signal [].
Probab=71.32 E-value=3.5 Score=34.53 Aligned_cols=9 Identities=22% Similarity=0.110 Sum_probs=3.6
Q ss_pred HHHHHHHHH
Q 042177 11 LMNLFLLVL 19 (123)
Q Consensus 11 lmnlfllvl 19 (123)
+|+-|..+|
T Consensus 137 ~~~~~~~~l 145 (432)
T PF09073_consen 137 IEEGLRQVL 145 (432)
T ss_pred HHHHHHHHh
Confidence 344444444
No 11
>PHA02664 hypothetical protein; Provisional
Probab=70.28 E-value=3.5 Score=37.06 Aligned_cols=6 Identities=83% Similarity=1.159 Sum_probs=2.6
Q ss_pred cccccc
Q 042177 64 SPHAAP 69 (123)
Q Consensus 64 ~~~A~P 69 (123)
+|.|+|
T Consensus 404 sp~aa~ 409 (534)
T PHA02664 404 SPMAAP 409 (534)
T ss_pred CcccCh
Confidence 444444
No 12
>PF10488 PP1c_bdg: Phosphatase-1 catalytic subunit binding region; InterPro: IPR019523 This entry represents the conserved C terminus of the regulatory subunit (15A and 15B) of protein phosphatase 1. This C-terminal domain appears to be a binding region for the catalytic subunit (PP1C) of protein phosphatase-1, which may in some circumstances also be retroviral in origin since it is found in both herpes simplex virus and in mouse and man. This domain is found in Gadd-34 apoptosis-associated proteins as well as the constitutive repressor of eIF2-alpha phosphorylation/protein phosphatase 1, regulatory (inhibitor) subunit 15b, otherwise known as CReP. Diverse stressful conditions are associated with phosphorylation of the alpha-subunit of eukaryotic translation initiation factor 2 (eIF2-alpha) on serine 51. This signaling event, which is conserved from yeast to mammals, negatively regulates the guanine nucleotide exchange factor, eIF2-B and inhibits the recycling of eIF2 to its active GTP bound form. In mammalian cells eIF2-alpha phosphorylation emerges as an important event in stress signaling that impacts on gene expression at both the translational and transcriptional levels [].
Probab=68.02 E-value=3.1 Score=35.36 Aligned_cols=20 Identities=20% Similarity=0.130 Sum_probs=8.3
Q ss_pred hhccccccccccCCCCCCCC
Q 042177 73 ATVNYATCKLYNNCTSTPES 92 (123)
Q Consensus 73 ~~~~yskgK~~~dSdSd~eS 92 (123)
-|+-|+.-....-+++++++
T Consensus 17 ~i~g~~~s~~~~ss~~~~~~ 36 (307)
T PF10488_consen 17 YILGGASSDLESSSDSEGED 36 (307)
T ss_pred cccccCccccccccccCccc
Confidence 34444333333334444443
No 13
>KOG1834 consensus Calsyntenin [Extracellular structures]
Probab=67.42 E-value=3.2 Score=39.73 Aligned_cols=13 Identities=23% Similarity=0.238 Sum_probs=6.2
Q ss_pred hhhhccccccccc
Q 042177 71 VNATVNYATCKLY 83 (123)
Q Consensus 71 ~N~~~~yskgK~~ 83 (123)
||-.=.|.++.-.
T Consensus 881 VNPme~~e~~gs~ 893 (952)
T KOG1834|consen 881 VNPMEDYEKGGSI 893 (952)
T ss_pred ecchHhcccCCcc
Confidence 4444455554433
No 14
>KOG4264 consensus Nucleo-cytoplasmic protein MLN51 [General function prediction only]
Probab=61.09 E-value=7.7 Score=36.24 Aligned_cols=21 Identities=14% Similarity=0.148 Sum_probs=8.9
Q ss_pred ccccccchhhhhc---cccccccc
Q 042177 63 LSPHAAPLVNATV---NYATCKLY 83 (123)
Q Consensus 63 ~~~~A~Pi~N~~~---~yskgK~~ 83 (123)
+||---|--|+.+ +|+.++..
T Consensus 45 slp~Q~p~~tgalHlrrvesa~~~ 68 (694)
T KOG4264|consen 45 SLPAQNPPQTGALHLRRVESAKPA 68 (694)
T ss_pred cCcccCCCccCccchhcccccCcc
Confidence 4444444444433 34444443
No 15
>KOG2925 consensus Predicted translation initiation factor related to eIF-1A [Translation, ribosomal structure and biogenesis]
Probab=57.04 E-value=9.6 Score=30.42 Aligned_cols=11 Identities=64% Similarity=0.658 Sum_probs=4.2
Q ss_pred CCCCCCCCCCC
Q 042177 91 ESESESEPDPD 101 (123)
Q Consensus 91 eSdSESEseSD 101 (123)
.|+||||+|+|
T Consensus 129 ls~sese~ddd 139 (167)
T KOG2925|consen 129 LSDSESEDDDD 139 (167)
T ss_pred CCCcccccccC
Confidence 33333333333
No 16
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=56.97 E-value=7.5 Score=38.72 Aligned_cols=18 Identities=17% Similarity=0.200 Sum_probs=7.8
Q ss_pred cccccccc-CCCCCCCCCC
Q 042177 77 YATCKLYN-NCTSTPESES 94 (123)
Q Consensus 77 yskgK~~~-dSdSd~eSdS 94 (123)
|+-|+... ++|+|+|.|.
T Consensus 1395 yEIGR~r~~~dd~DeeeD~ 1413 (1516)
T KOG1832|consen 1395 YEIGRRRPTDDDSDEEEDD 1413 (1516)
T ss_pred hhhcccCCCccccCccccc
Confidence 34455443 3344444433
No 17
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]
Probab=55.20 E-value=3.9 Score=36.77 Aligned_cols=24 Identities=21% Similarity=0.373 Sum_probs=20.4
Q ss_pred ccchhhhcccccccccchhhhhcc
Q 042177 53 AGLGLIGNALLSPHAAPLVNATVN 76 (123)
Q Consensus 53 aglgligna~~~~~A~Pi~N~~~~ 76 (123)
.|+.=-|..||.+||+|||+..+.
T Consensus 102 IglAeTGSGKT~afaLPIl~~LL~ 125 (476)
T KOG0330|consen 102 IGLAETGSGKTGAFALPILQRLLQ 125 (476)
T ss_pred EEEeccCCCchhhhHHHHHHHHHc
Confidence 356667888999999999999886
No 18
>KOG1425 consensus Microfibrillar-associated protein MFAP1 [Cytoskeleton]
Probab=54.42 E-value=5.8 Score=35.36 Aligned_cols=13 Identities=46% Similarity=0.716 Sum_probs=5.4
Q ss_pred ccccccccccCCC
Q 042177 107 ETESESESESESE 119 (123)
Q Consensus 107 ESdseSdSesDSE 119 (123)
+++.++||++|.+
T Consensus 170 e~ee~tdsEdD~~ 182 (430)
T KOG1425|consen 170 ESEEETDSEDDME 182 (430)
T ss_pred ccccccccccccc
Confidence 3334444444443
No 19
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=53.36 E-value=10 Score=39.36 Aligned_cols=6 Identities=0% Similarity=-0.230 Sum_probs=2.3
Q ss_pred cccccc
Q 042177 76 NYATCK 81 (123)
Q Consensus 76 ~yskgK 81 (123)
++-.|.
T Consensus 1724 egq~~e 1729 (3015)
T KOG0943|consen 1724 EGQEGE 1729 (3015)
T ss_pred cCCccc
Confidence 333343
No 20
>PF14998 Ripply: Transcription Regulator
Probab=52.03 E-value=7.2 Score=28.01 Aligned_cols=14 Identities=36% Similarity=0.534 Sum_probs=8.6
Q ss_pred cccccccCCCCCCC
Q 042177 78 ATCKLYNNCTSTPE 91 (123)
Q Consensus 78 skgK~~~dSdSd~e 91 (123)
+|..|++|||||+|
T Consensus 72 ATI~fY~Dsdsede 85 (87)
T PF14998_consen 72 ATIHFYEDSDSEDE 85 (87)
T ss_pred eEEEeccCCCcccc
Confidence 67778875544443
No 21
>KOG2141 consensus Protein involved in high osmolarity signaling pathway [Signal transduction mechanisms]
Probab=51.90 E-value=9.9 Score=36.25 Aligned_cols=9 Identities=44% Similarity=0.696 Sum_probs=3.7
Q ss_pred ccCcccccc
Q 042177 34 FKQPQVRDQ 42 (123)
Q Consensus 34 fkqpqvrdq 42 (123)
|+-|.|-++
T Consensus 177 ~~~~~~l~~ 185 (822)
T KOG2141|consen 177 LKLPKVLDS 185 (822)
T ss_pred cccchhhhh
Confidence 344444433
No 22
>PF01056 Myc_N: Myc amino-terminal region; InterPro: IPR012682 The class III basic helix-turn-helix (bHLH) transcription factors have proliferative and apoptotic roles and are characterised by the presence of a leucine zipper adjacent to the bHLH domain. The myc oncogene gene was first discovered in small-cell lung cancer cell lines where it is found to be deregulated []. Although the biochemical function of the gene product is unknown, as a nuclear protein with a short half-life it may play a direct or indirect role in controlling gene expression []. Myc forms a heterodimer with Max, and this complex regulates cell growth through direct activation of genes involved in cell replication []. This entry represents the N-terminal domain found adjacent to the basic helix-loop-helix (bHLH) region (IPR001092 from INTERPRO).; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1EE4_C.
Probab=49.35 E-value=5.6 Score=33.52 Aligned_cols=15 Identities=47% Similarity=0.499 Sum_probs=0.0
Q ss_pred cccccccccCCCCCC
Q 042177 108 TESESESESESEPDN 122 (123)
Q Consensus 108 SdseSdSesDSEsd~ 122 (123)
++++.++++++|=||
T Consensus 232 ~~~~eeeeeeEEIDV 246 (329)
T PF01056_consen 232 EEEEEEEEEEEEIDV 246 (329)
T ss_dssp ---------------
T ss_pred cccccccCCCcceEE
Confidence 333334444455444
No 23
>KOG2140 consensus Uncharacterized conserved protein [General function prediction only]
Probab=43.06 E-value=15 Score=34.64 Aligned_cols=11 Identities=18% Similarity=0.422 Sum_probs=5.6
Q ss_pred HHHHHHHHHHH
Q 042177 5 TKMFNVLMNLF 15 (123)
Q Consensus 5 tkmfnvlmnlf 15 (123)
.-||+-|.+-+
T Consensus 583 KilFqELve~l 593 (739)
T KOG2140|consen 583 KILFQELVEAL 593 (739)
T ss_pred HHHHHHHHHHh
Confidence 34566555543
No 24
>KOG2140 consensus Uncharacterized conserved protein [General function prediction only]
Probab=39.02 E-value=20 Score=33.79 Aligned_cols=16 Identities=6% Similarity=0.044 Sum_probs=7.7
Q ss_pred hcccccccccchhhhh
Q 042177 59 GNALLSPHAAPLVNAT 74 (123)
Q Consensus 59 gna~~~~~A~Pi~N~~ 74 (123)
-|+.-.-|+|-.+-+|
T Consensus 618 dnp~n~RfsINfFTsI 633 (739)
T KOG2140|consen 618 DNPRNTRFSINFFTSI 633 (739)
T ss_pred CCcccceeeeehhhhh
Confidence 3555555555544443
No 25
>PRK09993 C-lysozyme inhibitor; Provisional
Probab=32.21 E-value=31 Score=26.95 Aligned_cols=49 Identities=27% Similarity=0.331 Sum_probs=34.1
Q ss_pred hHHHHHHHHHHHHHHHhhc--cCCCCCCCcccccCccccc------cccccchhheecc
Q 042177 4 ITKMFNVLMNLFLLVLASN--AQGHNSNDEDIFKQPQVRD------QGERGVSKVVTAG 54 (123)
Q Consensus 4 itkmfnvlmnlfllvlasn--aqghnsndedifkqpqvrd------qgergvskvvtag 54 (123)
++.||..|+.++||+.+.. ||+- ..--++.+||..|. +|+| +-+-|+-|
T Consensus 3 ~~~~~~~l~aa~lL~~s~~a~Aq~d-~t~seLl~~p~yk~aw~~mvkg~~-LP~WV~~g 59 (153)
T PRK09993 3 GGMMFKALTTVAALVIATSAMAQDD-LTISSLAKGETTKAAFNQMVQGHK-LPAWVMKG 59 (153)
T ss_pred cchHHHHHHHHHHHHHHHHHHhcCC-ccHHHHhcCHHHHHHHHHHHcCCC-CcHHHHcC
Confidence 5789999999999886543 4443 33446668998875 5665 66666665
No 26
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=30.32 E-value=34 Score=32.17 Aligned_cols=8 Identities=25% Similarity=0.136 Sum_probs=3.1
Q ss_pred CCcccccC
Q 042177 29 NDEDIFKQ 36 (123)
Q Consensus 29 ndedifkq 36 (123)
+-+-+++|
T Consensus 98 ~veK~~~q 105 (678)
T KOG0127|consen 98 AVEKPIEQ 105 (678)
T ss_pred hhhccccc
Confidence 33333433
No 27
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=29.59 E-value=41 Score=35.33 Aligned_cols=13 Identities=0% Similarity=-0.171 Sum_probs=6.4
Q ss_pred hhccccccccccC
Q 042177 73 ATVNYATCKLYNN 85 (123)
Q Consensus 73 ~~~~yskgK~~~d 85 (123)
+-+.|+.-..+++
T Consensus 1728 ~ef~GEed~~Ddd 1740 (3015)
T KOG0943|consen 1728 GEFAGEEDHHDDD 1740 (3015)
T ss_pred ccccCcccccccc
Confidence 3455655554443
No 28
>PF08706 D5_N: D5 N terminal like; InterPro: IPR014818 This domain is found in D5 proteins of DNA viruses and bacteriophage P4 DNA primase.
Probab=29.29 E-value=21 Score=23.36 Aligned_cols=22 Identities=18% Similarity=0.247 Sum_probs=18.7
Q ss_pred ccccccchhhhhcccccccccc
Q 042177 63 LSPHAAPLVNATVNYATCKLYN 84 (123)
Q Consensus 63 ~~~~A~Pi~N~~~~yskgK~~~ 84 (123)
.-|+.||.-||+++-.+|++..
T Consensus 96 ~~~~~i~~~NGvldl~tg~l~~ 117 (150)
T PF08706_consen 96 ADPNLINFKNGVLDLRTGELRP 117 (150)
T ss_pred CCcCEEecCCEEEECCCCeecC
Confidence 3478999999999999999754
No 29
>PF00981 Rota_NS53: Rotavirus RNA-binding Protein 53 (NS53); InterPro: IPR002148 The proteins in this entry are variously described as either non-structural protein 1 (NSP1) or non-structural RNA-binding protein 53(NS53). They are RNA binding proteins that contain a characteristic cysteine rich region [, ]. They are made at low levels in infected cells and are a component of early replication and are known to accumulate on the cytoskeleton of the infected cell.; GO: 0003723 RNA binding
Probab=28.89 E-value=50 Score=30.10 Aligned_cols=34 Identities=35% Similarity=0.629 Sum_probs=29.0
Q ss_pred chhHHHHHHHHHHHHHHHhhcc-CCCCCCCccccc
Q 042177 2 VRITKMFNVLMNLFLLVLASNA-QGHNSNDEDIFK 35 (123)
Q Consensus 2 vritkmfnvlmnlfllvlasna-qghnsndedifk 35 (123)
.||.||+|-+|++.=...-||. -||-|.-|.|.+
T Consensus 336 fRi~~iYn~im~Firal~KSN~nvgHCSS~E~iY~ 370 (488)
T PF00981_consen 336 FRIKKIYNNIMSFIRALVKSNVNVGHCSSQESIYP 370 (488)
T ss_pred HhHHHHHHHHHHHHHHHHhcCCCccccccHHHHHH
Confidence 4899999999999888888886 599999887753
No 30
>PF09849 DUF2076: Uncharacterized protein conserved in bacteria (DUF2076); InterPro: IPR018648 This family of hypothetical prokaryotic proteins has no known function but includes putative perimplasmic ligand-binding sensor proteins.
Probab=28.43 E-value=2.3e+02 Score=23.01 Aligned_cols=9 Identities=33% Similarity=0.508 Sum_probs=6.7
Q ss_pred HHHHHHHHH
Q 042177 7 MFNVLMNLF 15 (123)
Q Consensus 7 mfnvlmnlf 15 (123)
+||.|+|||
T Consensus 154 L~n~i~~lF 162 (247)
T PF09849_consen 154 LANGIESLF 162 (247)
T ss_pred HHHHHHHHh
Confidence 577777777
No 31
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=27.77 E-value=49 Score=31.71 Aligned_cols=20 Identities=20% Similarity=-0.077 Sum_probs=11.9
Q ss_pred hhcccccccc---cchhhhhccc
Q 042177 58 IGNALLSPHA---APLVNATVNY 77 (123)
Q Consensus 58 igna~~~~~A---~Pi~N~~~~y 77 (123)
-+-|+++-|+ -|-+-||.+-
T Consensus 478 ~mKaKlLqF~~NrRP~YyGTWrK 500 (811)
T KOG4364|consen 478 RMKAKLLQFDKNRRPGYYGTWRK 500 (811)
T ss_pred hhHHHHhhhccccCCcccccccc
Confidence 3667777765 3555566543
No 32
>KOG3540 consensus Beta amyloid precursor protein [General function prediction only]
Probab=27.18 E-value=59 Score=30.31 Aligned_cols=24 Identities=21% Similarity=0.288 Sum_probs=17.0
Q ss_pred eeccchhhhcccccccccchhhhh
Q 042177 51 VTAGLGLIGNALLSPHAAPLVNAT 74 (123)
Q Consensus 51 vtaglgligna~~~~~A~Pi~N~~ 74 (123)
-|-|+-|-+-+.++|-++-.+-|+
T Consensus 161 ~tk~mil~~~gmLlPCg~D~F~Gv 184 (615)
T KOG3540|consen 161 STKGMILHSYGMLLPCGLDMFRGV 184 (615)
T ss_pred ccCCeeeecccceeccccccccCc
Confidence 345777778888899887666553
No 33
>KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis]
Probab=25.19 E-value=31 Score=33.14 Aligned_cols=6 Identities=50% Similarity=0.457 Sum_probs=2.1
Q ss_pred CCCCCC
Q 042177 87 TSTPES 92 (123)
Q Consensus 87 dSd~eS 92 (123)
+|+++|
T Consensus 10 ese~es 15 (843)
T KOG1076|consen 10 ESESES 15 (843)
T ss_pred cccccc
Confidence 333333
No 34
>COG5058 LAG1 Protein transporter of the TRAM (translocating chain-associating membrane) superfamily, longevity assurance factor [Intracellular trafficking and secretion]
Probab=24.69 E-value=40 Score=29.97 Aligned_cols=6 Identities=33% Similarity=0.490 Sum_probs=2.6
Q ss_pred HHHHHH
Q 042177 5 TKMFNV 10 (123)
Q Consensus 5 tkmfnv 10 (123)
.||.|.
T Consensus 276 sK~lnY 281 (395)
T COG5058 276 SKTLNY 281 (395)
T ss_pred HHHHHH
Confidence 444443
No 35
>PF08453 Peptidase_M9_N: Peptidase family M9 N-terminal; InterPro: IPR013661 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This domain is found in microbial collagenase metalloproteases to the N terminus of IPR013510 from INTERPRO. Proteins containing this domain belong tp MEROPS peptidase family M9, subfamilies M9A and M9B (microbial collagenase, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. Microbial collagenases have been identified from bacteria of both the Vibrio and Clostridium genuses. Collagenase is used during bacterial attack to degrade the collagen barrier of the host during invasion. Vibrio bacteria are non-pathogenic, and are sometimes used in hospitals to remove dead tissue from burns and ulcers. Clostridium histolyticum is a pathogen that causes gas gangrene; nevertheless, the isolated collagenase has been used to treat bed sores. Collagen cleavage occurs at an Xaa+Gly in Vibrio bacteria and at Yaa+Gly bonds in Clostridium collagenases. Analysis of the primary structure of the gene product from Clostridium perfringens has revealed that the enzyme is produced with a stretch of 86 residues that contain a putative signal sequence []. Within this stretch is found PLGP, an amino acid sequence typical of collagenase substrates. This sequence may thus be implicated in self-processing of the collagenase [].; GO: 0004252 serine-type endopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 2Y3U_A 2Y6I_A 2Y50_A.
Probab=24.26 E-value=12 Score=28.35 Aligned_cols=45 Identities=24% Similarity=0.234 Sum_probs=32.0
Q ss_pred ccccCccccccccccchhheeccchhhhcccccccccchhhhhccc
Q 042177 32 DIFKQPQVRDQGERGVSKVVTAGLGLIGNALLSPHAAPLVNATVNY 77 (123)
Q Consensus 32 difkqpqvrdqgergvskvvtaglgligna~~~~~A~Pi~N~~~~y 77 (123)
.+++.|-..+++ +.--+|+..-+-||+|++..|..+|.+-.+|+.
T Consensus 105 af~~np~~~~~t-~~q~~vl~e~~~lids~~~~~~~l~~~~~~L~~ 149 (190)
T PF08453_consen 105 AFFANPNFFDGT-DEQGKVLKELGILIDSAKQNAEYLPVVKQILNQ 149 (190)
T ss_dssp HHHHSTTGSS-S-HHHHHHHHHHHHHHHHS---HHHHHTTHHHHHH
T ss_pred HHHhCchhhhcc-hhHHHHHHHHHHHhcCCcccHHHHHHHHHHHHH
Confidence 357778888855 445578888888999999999999988877764
No 36
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]
Probab=23.77 E-value=57 Score=29.31 Aligned_cols=7 Identities=29% Similarity=0.672 Sum_probs=2.7
Q ss_pred ccccccc
Q 042177 107 ETESESE 113 (123)
Q Consensus 107 ESdseSd 113 (123)
|.|+|++
T Consensus 418 edded~~ 424 (434)
T KOG3555|consen 418 EDDEDSD 424 (434)
T ss_pred ccccccc
Confidence 3333333
No 37
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning]
Probab=23.69 E-value=64 Score=29.62 Aligned_cols=11 Identities=18% Similarity=0.153 Sum_probs=5.6
Q ss_pred chhhhhccccc
Q 042177 69 PLVNATVNYAT 79 (123)
Q Consensus 69 Pi~N~~~~ysk 79 (123)
-+++.++.+-+
T Consensus 420 ~~~~~~~t~l~ 430 (520)
T KOG2270|consen 420 NLLYTTITGLD 430 (520)
T ss_pred cchhhhhhccc
Confidence 34555555543
No 38
>KOG2959 consensus Transcriptional regulator [Transcription]
Probab=23.63 E-value=58 Score=27.26 Aligned_cols=31 Identities=32% Similarity=0.424 Sum_probs=0.0
Q ss_pred CCCCCCCCCCCCCCCCcccccccccccccCCC
Q 042177 88 STPESESESEPDPDAESESETESESESESESE 119 (123)
Q Consensus 88 Sd~eSdSESEseSDSESeSESdseSdSesDSE 119 (123)
||.+++---.+++.+||+++.++.|+ .++||
T Consensus 48 ~De~~~~~~~~~~~EE~~~~d~~~S~-n~~SE 78 (238)
T KOG2959|consen 48 SDEDEDRAAASSSEEESSSGDESNSS-NSQSE 78 (238)
T ss_pred cccccccccccccccccccccccccc-ccccc
No 39
>KOG2652 consensus RNA polymerase II transcription initiation factor TFIIA, large chain [Transcription]
Probab=23.16 E-value=72 Score=27.88 Aligned_cols=8 Identities=13% Similarity=0.235 Sum_probs=3.4
Q ss_pred cchhhhhc
Q 042177 68 APLVNATV 75 (123)
Q Consensus 68 ~Pi~N~~~ 75 (123)
|+.+.+-+
T Consensus 240 i~qv~~~~ 247 (348)
T KOG2652|consen 240 IAQVDLSL 247 (348)
T ss_pred hhhhcccc
Confidence 44444433
No 40
>KOG0262 consensus RNA polymerase I, large subunit [Transcription]
Probab=22.80 E-value=66 Score=33.02 Aligned_cols=14 Identities=36% Similarity=0.477 Sum_probs=7.4
Q ss_pred HHHHHHHHHHHHHh
Q 042177 7 MFNVLMNLFLLVLA 20 (123)
Q Consensus 7 mfnvlmnlfllvla 20 (123)
..+++-|-||..|.
T Consensus 1281 i~~~m~~~Flk~L~ 1294 (1640)
T KOG0262|consen 1281 IEEVMENRFLKLLE 1294 (1640)
T ss_pred HHHHHHHHHHHHHH
Confidence 34555555655553
No 41
>KOG0347 consensus RNA helicase [RNA processing and modification]
Probab=22.80 E-value=31 Score=32.66 Aligned_cols=20 Identities=20% Similarity=0.308 Sum_probs=16.3
Q ss_pred ccchhhhcccccccccchhh
Q 042177 53 AGLGLIGNALLSPHAAPLVN 72 (123)
Q Consensus 53 aglgligna~~~~~A~Pi~N 72 (123)
.|..=-|..||+||+||||-
T Consensus 223 lGaAeTGSGKTLAFGIPiv~ 242 (731)
T KOG0347|consen 223 LGAAETGSGKTLAFGIPIVE 242 (731)
T ss_pred ccccccCCCceeeecchhhh
Confidence 45556678899999999997
No 42
>PF08401 DUF1738: Domain of unknown function (DUF1738); InterPro: IPR013610 This region is found in a number of bacterial hypothetical proteins. Some members are annotated as being similar to replication primases, and in fact this region is often found together with the Toprim domain (IPR006171 from INTERPRO).
Probab=22.78 E-value=40 Score=23.73 Aligned_cols=28 Identities=32% Similarity=0.341 Sum_probs=23.3
Q ss_pred HHHHHHHHHhhccCCCCCCCcccccCcc
Q 042177 11 LMNLFLLVLASNAQGHNSNDEDIFKQPQ 38 (123)
Q Consensus 11 lmnlfllvlasnaqghnsndedifkqpq 38 (123)
-+|.++|.++...+|+.++-=--|+|-+
T Consensus 48 G~N~l~L~~~~~~~gy~~prw~Tf~Qak 75 (125)
T PF08401_consen 48 GINALLLWLAAEENGYKDPRWMTFKQAK 75 (125)
T ss_pred eehHHHHHHHHHHcCCCCCcEEcHHHHH
Confidence 3789999999999999988877777654
No 43
>KOG3228 consensus Uncharacterized conserved protein [Function unknown]
Probab=21.64 E-value=45 Score=27.76 Aligned_cols=7 Identities=43% Similarity=0.838 Sum_probs=2.8
Q ss_pred ccccccc
Q 042177 107 ETESESE 113 (123)
Q Consensus 107 ESdseSd 113 (123)
++++|||
T Consensus 118 d~d~esD 124 (226)
T KOG3228|consen 118 DSDSESD 124 (226)
T ss_pred ccccccc
Confidence 3333444
No 44
>PF03419 Peptidase_U4: Sporulation factor SpoIIGA This family belongs to family U4 of the peptidase classification.; InterPro: IPR005081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported. This group of peptidases belong to the MEROPS peptidase family U4 (SpoIIGA peptidase family, clan U-). Sporulation in bacteria such as Bacillus subtilis involves the formation of a polar septum, which divides the sporangium into a mother cell and a forespore. The sigma E factor, which is encoded within the spoIIG operon, is a cell-specific regulatory protein that directs gene transcription in the mother cell. Sigma E is synthesised as an inactive proprotein pro-sigma E, which is converted to the mature factor by the putative processing enzyme SpoIIGA []. ; GO: 0004190 aspartic-type endopeptidase activity, 0006508 proteolysis, 0030436 asexual sporulation
Probab=21.61 E-value=81 Score=24.64 Aligned_cols=22 Identities=32% Similarity=0.446 Sum_probs=17.0
Q ss_pred HHHHHHHHHHHHHHhhccCCCC
Q 042177 6 KMFNVLMNLFLLVLASNAQGHN 27 (123)
Q Consensus 6 kmfnvlmnlfllvlasnaqghn 27 (123)
=+.|.+||+++|.++.-..+..
T Consensus 9 fl~N~~md~~lL~~t~~~~~~~ 30 (293)
T PF03419_consen 9 FLVNFLMDYFLLWLTARLLKRR 30 (293)
T ss_pred HHHHHHHHHHHHHHHHHHhcCC
Confidence 4579999999999987655443
No 45
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis]
Probab=21.54 E-value=59 Score=30.62 Aligned_cols=42 Identities=26% Similarity=0.480 Sum_probs=29.9
Q ss_pred cCccccccccccchhheeccchhhhcccc-----------cccccchhhhhcc
Q 042177 35 KQPQVRDQGERGVSKVVTAGLGLIGNALL-----------SPHAAPLVNATVN 76 (123)
Q Consensus 35 kqpqvrdqgergvskvvtaglgligna~~-----------~~~A~Pi~N~~~~ 76 (123)
+||--++--|.|+-++-..++|..|+.-. .|.+-|+.|...|
T Consensus 424 ~~p~~eesdee~~~~~~l~siG~~G~gyi~~~~~~~dee~~~~~~~~~~~k~n 476 (673)
T KOG1461|consen 424 RQPTTEESDEEGLDDVKLKSIGPDGAGYIWETEDADDEEWKPLVPPSPNDKTN 476 (673)
T ss_pred cCCcccccchhhccchheeeccCCcceeeecccCcccccccccccCCcccccc
Confidence 56666666666777777778888887643 3567788888777
No 46
>KOG2147 consensus Nucleolar protein involved in 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]
Probab=20.82 E-value=72 Score=30.72 Aligned_cols=13 Identities=15% Similarity=0.153 Sum_probs=6.8
Q ss_pred hccccccccccCC
Q 042177 74 TVNYATCKLYNNC 86 (123)
Q Consensus 74 ~~~yskgK~~~dS 86 (123)
-+-+..|++-...
T Consensus 312 ~~~~ddgk~l~~E 324 (823)
T KOG2147|consen 312 EVDFDDGKGLEEE 324 (823)
T ss_pred ccccccccccccc
Confidence 3445666655433
No 47
>PHA03151 hypothetical protein; Provisional
Probab=20.21 E-value=85 Score=26.54 Aligned_cols=11 Identities=36% Similarity=0.661 Sum_probs=5.7
Q ss_pred cccCccccccc
Q 042177 33 IFKQPQVRDQG 43 (123)
Q Consensus 33 ifkqpqvrdqg 43 (123)
.||-|.-.+.+
T Consensus 35 yFkFPp~~~~~ 45 (259)
T PHA03151 35 VFKFPTDEDDS 45 (259)
T ss_pred eeeCCCCcccC
Confidence 46666554443
No 48
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]
Probab=20.20 E-value=37 Score=30.54 Aligned_cols=18 Identities=22% Similarity=0.344 Sum_probs=13.3
Q ss_pred hhhcccccccccchhhhh
Q 042177 57 LIGNALLSPHAAPLVNAT 74 (123)
Q Consensus 57 ligna~~~~~A~Pi~N~~ 74 (123)
--|..||.+||+||+|-.
T Consensus 52 kTGsGKT~AFaLPil~rL 69 (442)
T KOG0340|consen 52 KTGSGKTAAFALPILNRL 69 (442)
T ss_pred ccCCCcchhhhHHHHHhh
Confidence 344556789999999853
No 49
>TIGR02854 spore_II_GA sigma-E processing peptidase SpoIIGA. Members of this protein family are the stage II sporulation protein SpoIIGA. This protein acts as an activating protease for Sigma-E, one of several specialized sigma factors of the sporulation process in Bacillus subtilis and related endospore-forming bacteria.
Probab=20.15 E-value=89 Score=24.95 Aligned_cols=20 Identities=25% Similarity=0.414 Sum_probs=15.5
Q ss_pred HHHHHHHHHHHHHHhhccCC
Q 042177 6 KMFNVLMNLFLLVLASNAQG 25 (123)
Q Consensus 6 kmfnvlmnlfllvlasnaqg 25 (123)
=+.|.+||.|||.++.-.-+
T Consensus 9 ~l~Nf~~d~~LL~~t~~~lk 28 (288)
T TIGR02854 9 FLENFIIDYFLLYLTARTLK 28 (288)
T ss_pred HHHHHHHHHHHHHHHHHHhh
Confidence 46799999999998875443
Done!