BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042186
         (57 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3NGV|A Chain A, Crystal Structure Of Anst-D7l1
 pdb|3NHI|A Chain A, Crystal Structure Of The Anst-D7l1-Leukotriene C4 Complex
 pdb|3NHT|A Chain A, Crystal Structure Of The Anst-D7l1-U46619 Complex
          Length = 296

 Score = 26.9 bits (58), Expect = 3.1,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 18  PDIMFHLEKSISYCRKRSWTGVWQSKVKHSAANKL 52
           P+I    E   +YC KR+W G  QS+ K+    KL
Sbjct: 146 PEIKQKGESFHAYCEKRAWKGNKQSEWKNGRRYKL 180


>pdb|1W63|Q Chain Q, Ap1 Clathrin Adaptor Core
 pdb|1W63|S Chain S, Ap1 Clathrin Adaptor Core
 pdb|1W63|T Chain T, Ap1 Clathrin Adaptor Core
 pdb|1W63|U Chain U, Ap1 Clathrin Adaptor Core
 pdb|1W63|W Chain W, Ap1 Clathrin Adaptor Core
 pdb|1W63|X Chain X, Ap1 Clathrin Adaptor Core
          Length = 158

 Score = 26.2 bits (56), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%)

Query: 6   ETADCGFGILCEPDIMFHLEKS 27
           E  D  FG +CE DI+F+ EK+
Sbjct: 89  ELLDKYFGSVCELDIIFNFEKA 110


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.133    0.437 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,632,240
Number of Sequences: 62578
Number of extensions: 42298
Number of successful extensions: 120
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 118
Number of HSP's gapped (non-prelim): 2
length of query: 57
length of database: 14,973,337
effective HSP length: 29
effective length of query: 28
effective length of database: 13,158,575
effective search space: 368440100
effective search space used: 368440100
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)