BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042194
         (364 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3OO8|A Chain A, Crystal Structures And Biochemical Characterization Of The
           Bacterial Solute Receptor Acbh Reveal An Unprecedented
           Exclusive Substrate Preference For B-D-Galactopyranose
          Length = 415

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 296 NGMITSQYGDIDKEIIV-FGETKSLSSFLEDYFGFHHDRLPITAVVLI 342
           NG+I   Y DI K+ +   G+ KS+S F+E       D +P  A  +I
Sbjct: 343 NGLIAPTYNDIQKKSVAEIGKCKSVSQFME------RDTVPDMANAMI 384


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.141    0.451 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,016,261
Number of Sequences: 62578
Number of extensions: 445417
Number of successful extensions: 1167
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1167
Number of HSP's gapped (non-prelim): 3
length of query: 364
length of database: 14,973,337
effective HSP length: 100
effective length of query: 264
effective length of database: 8,715,537
effective search space: 2300901768
effective search space used: 2300901768
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)