BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 042194
(364 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3OO8|A Chain A, Crystal Structures And Biochemical Characterization Of The
Bacterial Solute Receptor Acbh Reveal An Unprecedented
Exclusive Substrate Preference For B-D-Galactopyranose
Length = 415
Score = 29.3 bits (64), Expect = 4.0, Method: Compositional matrix adjust.
Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 7/48 (14%)
Query: 296 NGMITSQYGDIDKEIIV-FGETKSLSSFLEDYFGFHHDRLPITAVVLI 342
NG+I Y DI K+ + G+ KS+S F+E D +P A +I
Sbjct: 343 NGLIAPTYNDIQKKSVAEIGKCKSVSQFME------RDTVPDMANAMI 384
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.141 0.451
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,016,261
Number of Sequences: 62578
Number of extensions: 445417
Number of successful extensions: 1167
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1167
Number of HSP's gapped (non-prelim): 3
length of query: 364
length of database: 14,973,337
effective HSP length: 100
effective length of query: 264
effective length of database: 8,715,537
effective search space: 2300901768
effective search space used: 2300901768
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)