BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042250
         (186 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4GZO|A Chain A, N2 Neuraminidase Of ATANZANIA2052010 H3N2 IN COMPLEX WITH
           HEPES
 pdb|4GZP|A Chain A, N2 Neuraminidase Of ATANZANIA2052010 H3N2 IN COMPLEX WITH
           Oseltamivir Carboxylate
 pdb|4GZQ|A Chain A, N2 Neuraminidase Of ATANZANIA2052010 H3N2 IN COMPLEX WITH
           SIALIC Acid
          Length = 393

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 6/40 (15%)

Query: 87  IVDRGSTSCGVSGSLYAIILCLTGCSCLYSCFYRSKLRGQ 126
           IVDRG+ S G SG     I  + G SC+  CFY   +RG+
Sbjct: 321 IVDRGNRS-GYSG-----IFSVEGKSCINRCFYVELIRGR 354


>pdb|2AEP|A Chain A, An Epidemiologically Significant Epitope Of A 1998
           Influenza Virus Neuraminidase Forms A Highly Hydrated
           Interface In The Na-Antibody Complex.
 pdb|2AEQ|A Chain A, An Epidemiologically Significant Epitope Of A 1998
           Influenza Virus Neuraminidase Forms A Highly Hydrated
           Interface In The Na-Antibody Complex
          Length = 395

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 6/40 (15%)

Query: 87  IVDRGSTSCGVSGSLYAIILCLTGCSCLYSCFYRSKLRGQ 126
           IVDRG+ S G SG     I  + G SC+  CFY   +RG+
Sbjct: 323 IVDRGNRS-GYSG-----IFSVEGKSCINRCFYVELIRGR 356


>pdb|4GZS|A Chain A, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Hepes
 pdb|4GZS|B Chain B, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Hepes
 pdb|4GZS|C Chain C, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Hepes
 pdb|4GZS|D Chain D, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Hepes
 pdb|4GZT|A Chain A, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Oseltamivir Carboxylate
 pdb|4GZT|B Chain B, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Oseltamivir Carboxylate
 pdb|4GZT|C Chain C, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Oseltamivir Carboxylate
 pdb|4GZT|D Chain D, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Oseltamivir Carboxylate
 pdb|4GZW|A Chain A, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Avian Sialic Acid Receptor
 pdb|4GZW|B Chain B, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Avian Sialic Acid Receptor
 pdb|4GZW|C Chain C, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Avian Sialic Acid Receptor
 pdb|4GZW|D Chain D, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Avian Sialic Acid Receptor
 pdb|4GZX|A Chain A, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Human Sialic Acid Receptor
 pdb|4GZX|B Chain B, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Human Sialic Acid Receptor
 pdb|4GZX|C Chain C, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Human Sialic Acid Receptor
 pdb|4GZX|D Chain D, N2 Neuraminidase D151g Mutant Of ATANZANIA2052010 H3N2 IN
           COMPLEX With Human Sialic Acid Receptor
          Length = 393

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 6/40 (15%)

Query: 87  IVDRGSTSCGVSGSLYAIILCLTGCSCLYSCFYRSKLRGQ 126
           IVDRG+ S G SG     I  + G SC+  CFY   +RG+
Sbjct: 321 IVDRGNRS-GYSG-----IFSVEGKSCINRCFYVELIRGR 354


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.134    0.442 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,725,294
Number of Sequences: 62578
Number of extensions: 94035
Number of successful extensions: 149
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 149
Number of HSP's gapped (non-prelim): 3
length of query: 186
length of database: 14,973,337
effective HSP length: 93
effective length of query: 93
effective length of database: 9,153,583
effective search space: 851283219
effective search space used: 851283219
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)