Query         042254
Match_columns 159
No_of_seqs    98 out of 100
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 04:25:53 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042254.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042254hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07204 Orthoreo_P10:  Orthore  88.8    0.26 5.7E-06   37.8   1.7   37   28-64     36-72  (98)
  2 PF01102 Glycophorin_A:  Glycop  85.8       1 2.2E-05   35.2   3.5   34   28-62     59-92  (122)
  3 TIGR00847 ccoS cytochrome oxid  82.5     3.1 6.7E-05   28.3   4.3   34   34-70      3-36  (51)
  4 PF02439 Adeno_E3_CR2:  Adenovi  80.6     3.5 7.5E-05   26.9   3.8   28   37-64      8-35  (38)
  5 PF03597 CcoS:  Cytochrome oxid  79.5     4.6  0.0001   26.7   4.2   34   34-70      2-35  (45)
  6 PF15347 PAG:  Phosphoprotein a  70.9     3.3 7.1E-05   38.6   2.5   24   36-59     16-39  (428)
  7 PRK13592 ubiA prenyltransferas  66.4       7 0.00015   34.7   3.5   28   31-58    232-260 (299)
  8 PF12273 RCR:  Chitin synthesis  64.8     6.4 0.00014   29.7   2.6   11   97-107    61-71  (130)
  9 PF05283 MGC-24:  Multi-glycosy  64.7     6.5 0.00014   32.8   2.8   22   34-55    160-181 (186)
 10 PF11174 DUF2970:  Protein of u  63.7      11 0.00025   25.8   3.4   19   31-49     28-46  (56)
 11 TIGR00822 EII-Sor PTS system,   57.9      27 0.00059   30.4   5.5   27   33-59    205-235 (265)
 12 PHA03283 envelope glycoprotein  57.9      12 0.00026   36.1   3.6   31   28-60    393-425 (542)
 13 PF05151 PsbM:  Photosystem II   57.1     8.8 0.00019   24.1   1.8   14   45-58      6-19  (31)
 14 PF10215 Ost4:  Oligosaccaryltr  55.9      18  0.0004   23.0   3.1   18   38-55      7-24  (35)
 15 PF09928 DUF2160:  Predicted sm  55.5      12 0.00027   28.2   2.7   22   29-50      3-24  (88)
 16 PRK13726 conjugal transfer pil  55.2      38 0.00081   28.0   5.7   34   31-64      7-43  (188)
 17 PHA02909 hypothetical protein;  54.7      13 0.00029   26.8   2.6    9   52-60     49-57  (72)
 18 PF13295 DUF4077:  Domain of un  52.9     5.4 0.00012   32.7   0.4   29   34-62    112-140 (175)
 19 PF12911 OppC_N:  N-terminal TM  52.8      15 0.00033   23.5   2.5   15   43-57     18-32  (56)
 20 PF14991 MLANA:  Protein melan-  52.7     2.4 5.1E-05   33.6  -1.6   21   46-66     33-54  (118)
 21 PF02480 Herpes_gE:  Alphaherpe  52.6     4.6  0.0001   37.1   0.0   36   26-61    343-379 (439)
 22 PRK14094 psbM photosystem II r  51.9      21 0.00045   24.6   3.1   15   44-58      5-19  (50)
 23 PF12273 RCR:  Chitin synthesis  51.7       7 0.00015   29.5   0.9   12   46-57     10-21  (130)
 24 PF15339 Afaf:  Acrosome format  51.5      19 0.00041   30.7   3.5   23   36-58    131-153 (200)
 25 PF01998 DUF131:  Protein of un  49.1       7 0.00015   27.6   0.5   24   33-56     33-59  (64)
 26 PF05399 EVI2A:  Ectropic viral  48.5      17 0.00036   31.6   2.7   19   41-59    128-146 (227)
 27 TIGR03007 pepcterm_ChnLen poly  46.7      44 0.00096   29.8   5.2   38   25-63    404-441 (498)
 28 PF14241 DUF4341:  Domain of un  46.6      30 0.00065   23.7   3.3   22   32-55      1-22  (62)
 29 PF01299 Lamp:  Lysosome-associ  46.2      17 0.00036   31.1   2.4   29   34-64    273-301 (306)
 30 PRK09757 PTS system N-acetylga  45.8      27 0.00058   30.3   3.6   28   33-60    206-238 (267)
 31 PRK15065 PTS system mannose-sp  44.2      55  0.0012   28.5   5.3   27   33-59    206-236 (262)
 32 PRK05419 putative sulfite oxid  43.7      28  0.0006   28.8   3.2   30   33-62    113-142 (205)
 33 PF14575 EphA2_TM:  Ephrin type  43.4      23 0.00051   25.1   2.4   23   40-62      6-28  (75)
 34 PF02480 Herpes_gE:  Alphaherpe  42.8     8.1 0.00018   35.6   0.0   45   20-64    341-385 (439)
 35 PF04277 OAD_gamma:  Oxaloaceta  42.6      21 0.00046   24.4   2.1   11   85-95     61-71  (79)
 36 COG3197 FixS Uncharacterized p  42.5      33 0.00072   24.2   3.0   33   35-70      4-36  (58)
 37 CHL00080 psbM photosystem II p  42.3      25 0.00055   22.5   2.2   15   44-58      5-19  (34)
 38 PF15048 OSTbeta:  Organic solu  41.4      35 0.00076   27.3   3.4   28   27-58     32-59  (125)
 39 PF09049 SNN_transmemb:  Stanni  41.1      82  0.0018   20.0   4.3   27   31-60      6-33  (33)
 40 PRK12785 fliL flagellar basal   40.3      33 0.00071   27.3   3.1   22   85-107    70-93  (166)
 41 TIGR03038 PS_II_psbM photosyst  40.1      29 0.00062   22.1   2.2   13   44-56      5-17  (33)
 42 COG4961 TadG Flp pilus assembl  39.8      29 0.00063   27.7   2.7   20   39-58     21-40  (185)
 43 PF05568 ASFV_J13L:  African sw  39.1      40 0.00088   28.3   3.5   23   41-63     36-58  (189)
 44 PF10883 DUF2681:  Protein of u  39.0      29 0.00063   25.9   2.4   21   43-63      6-26  (87)
 45 PF06596 PsbX:  Photosystem II   37.5      56  0.0012   21.4   3.3   20   37-56     12-31  (39)
 46 COG4736 CcoQ Cbb3-type cytochr  37.5      55  0.0012   23.0   3.5   27   37-63      5-31  (60)
 47 PF11980 DUF3481:  Domain of un  37.1      38 0.00083   25.7   2.8   25   36-60     18-43  (87)
 48 PRK04989 psbM photosystem II r  37.0      34 0.00073   22.1   2.1   15   44-58      5-19  (35)
 49 PF15330 SIT:  SHP2-interacting  36.8      48   0.001   25.3   3.4   27   37-63      2-28  (107)
 50 PF03916 NrfD:  Polysulphide re  36.8      40 0.00086   28.4   3.2   23   25-47    165-188 (313)
 51 PF13807 GNVR:  G-rich domain o  36.7      65  0.0014   22.3   3.8   20   31-50     54-73  (82)
 52 PF05255 UPF0220:  Uncharacteri  36.0      44 0.00095   27.2   3.2   28   35-62    101-128 (166)
 53 COG3190 FliO Flagellar biogene  35.3      93   0.002   25.1   4.9   61   32-98     22-82  (137)
 54 PLN00085 photosystem II reacti  34.8      44 0.00096   27.2   3.0   22   44-65     82-109 (149)
 55 COG5416 Uncharacterized integr  33.9      58  0.0013   25.2   3.4   35   21-55     48-82  (98)
 56 cd02435 CCC1 CCC1. CCC1: This   33.6      59  0.0013   27.6   3.8   30   34-63    173-207 (241)
 57 PF14914 LRRC37AB_C:  LRRC37A/B  32.6      52  0.0011   27.2   3.2   23   42-64    129-151 (154)
 58 PF04976 DmsC:  DMSO reductase   32.3      62  0.0013   27.4   3.7   28   25-52    140-168 (276)
 59 TIGR02976 phageshock_pspB phag  31.6      60  0.0013   23.5   3.0   28   36-63      3-30  (75)
 60 PF11143 DUF2919:  Protein of u  31.4      48   0.001   26.5   2.7   23   40-63     57-79  (149)
 61 PF04133 Vps55:  Vacuolar prote  31.1      50  0.0011   25.6   2.7   19   44-62      6-24  (120)
 62 PF06103 DUF948:  Bacterial pro  30.7      45 0.00098   23.4   2.2   12   47-58      5-16  (90)
 63 PF06667 PspB:  Phage shock pro  30.5      64  0.0014   23.4   3.0   27   36-62      3-29  (75)
 64 PF01794 Ferric_reduct:  Ferric  30.4      95  0.0021   21.6   3.8   27   33-59     76-102 (125)
 65 PF13903 Claudin_2:  PMP-22/EMP  29.9      81  0.0018   23.0   3.6   24   37-60     73-96  (172)
 66 PTZ00370 STEVOR; Provisional    29.8      53  0.0012   29.6   3.0   24   39-62    258-282 (296)
 67 cd01324 cbb3_Oxidase_CcoQ Cyto  29.8 1.2E+02  0.0026   20.0   4.0   28   37-64      6-36  (48)
 68 PF15240 Pro-rich:  Proline-ric  29.6      35 0.00077   28.6   1.8   13   44-56      2-14  (179)
 69 PF04478 Mid2:  Mid2 like cell   29.5      19 0.00041   29.6   0.1   26   40-65     57-82  (154)
 70 PF03229 Alpha_GJ:  Alphavirus   28.7      96  0.0021   24.9   4.0   37   26-62     73-116 (126)
 71 PF09680 Tiny_TM_bacill:  Prote  28.5      38 0.00082   20.3   1.3   20   40-60      5-24  (24)
 72 PF03381 CDC50:  LEM3 (ligand-e  28.2   1E+02  0.0022   26.5   4.4   35   28-62    239-273 (278)
 73 PHA00736 hypothetical protein   28.0      51  0.0011   24.3   2.2   14   37-50     57-70  (79)
 74 PRK13823 conjugal transfer pro  27.8      48   0.001   24.9   2.1   18   35-52     15-36  (94)
 75 cd01059 CCC1_like CCC1-related  27.7      97  0.0021   23.8   3.8   30   34-63     79-114 (143)
 76 PF13908 Shisa:  Wnt and FGF in  27.5      27 0.00058   27.5   0.7    6   31-36     70-75  (179)
 77 PF06814 Lung_7-TM_R:  Lung sev  27.2      96  0.0021   26.1   4.0   36   28-63     41-76  (295)
 78 PF01594 UPF0118:  Domain of un  27.0      89  0.0019   25.7   3.7   26   36-61    302-327 (327)
 79 PRK10081 entericidin B membran  26.7      75  0.0016   21.6   2.6   21   41-61      6-26  (48)
 80 TIGR03054 photo_alph_chp1 puta  26.7      59  0.0013   26.0   2.5   23   40-62      3-25  (135)
 81 PRK10884 SH3 domain-containing  26.7      55  0.0012   27.3   2.4   18   36-54    174-191 (206)
 82 KOG1053 Glutamate-gated NMDA-t  26.3      59  0.0013   34.0   2.9   26   38-63    826-855 (1258)
 83 PRK12361 hypothetical protein;  26.3      84  0.0018   28.9   3.7   14   48-61     37-50  (547)
 84 PF10826 DUF2551:  Protein of u  26.1      50  0.0011   24.8   1.8   20   38-57     43-62  (83)
 85 PF05454 DAG1:  Dystroglycan (D  25.7      23  0.0005   31.4   0.0   11   89-100   209-219 (290)
 86 PF06800 Sugar_transport:  Suga  25.4      89  0.0019   27.4   3.5   33   26-62     93-125 (269)
 87 PRK13792 lysozyme inhibitor; P  25.3      37  0.0008   26.8   1.1   21   42-62      4-24  (127)
 88 KOG0499 Cyclic nucleotide-gate  25.3      71  0.0015   32.1   3.2   25   31-55    425-449 (815)
 89 PRK09458 pspB phage shock prot  25.1      90  0.0019   23.0   3.0   27   36-62      3-29  (75)
 90 PF01431 Peptidase_M13:  Peptid  24.9      63  0.0014   25.3   2.3   23   25-47     20-42  (206)
 91 PRK07021 fliL flagellar basal   24.8 2.6E+02  0.0056   21.9   5.8   22   85-107    63-85  (162)
 92 PRK05696 fliL flagellar basal   24.1 2.9E+02  0.0063   21.8   5.9   22   86-107    72-93  (170)
 93 PF11353 DUF3153:  Protein of u  24.0      79  0.0017   25.7   2.8    7   25-31    177-183 (209)
 94 PF06716 DUF1201:  Protein of u  23.8 1.2E+02  0.0027   21.0   3.3   28   35-62      7-34  (54)
 95 PF07937 DUF1686:  Protein of u  23.7      63  0.0014   27.4   2.2   18   44-61    129-146 (185)
 96 TIGR03750 conj_TIGR03750 conju  23.7 1.1E+02  0.0025   23.6   3.5   29   32-60     39-69  (111)
 97 cd02434 Nodulin-21_like_3 Nodu  23.6      94   0.002   25.9   3.3   23   41-63    172-195 (225)
 98 COG1704 LemA Uncharacterized c  23.5      67  0.0015   27.1   2.3   24   41-64      4-27  (185)
 99 PRK11486 flagellar biosynthesi  23.4 1.3E+02  0.0028   23.7   3.8   56   43-98     21-76  (124)
100 PF11677 DUF3273:  Protein of u  23.4 1.7E+02  0.0037   26.0   4.9   39   25-63      6-46  (265)
101 PF15345 TMEM51:  Transmembrane  23.4      44 0.00094   29.2   1.3   30   27-56     53-82  (233)
102 cd02437 CCC1_like_1 CCC1-relat  23.3 1.2E+02  0.0027   24.0   3.7   16   48-63    131-146 (175)
103 TIGR03363 VI_chp_8 type VI sec  23.2      40 0.00086   29.7   1.0    9   31-39    313-321 (353)
104 TIGR01167 LPXTG_anchor LPXTG-m  23.1 1.2E+02  0.0026   17.5   2.8    7   35-41     12-18  (34)
105 PF02411 MerT:  MerT mercuric t  22.9   1E+02  0.0022   23.8   3.1   17   47-63     54-70  (116)
106 PF07589 VPEP:  PEP-CTERM motif  22.8   1E+02  0.0023   17.8   2.4   11   47-57     10-20  (25)
107 PF00822 PMP22_Claudin:  PMP-22  22.7 1.1E+02  0.0025   22.6   3.3   29   37-65      3-33  (166)
108 PF11153 DUF2931:  Protein of u  22.4      70  0.0015   25.9   2.2   18   46-63      5-22  (216)
109 PF06305 DUF1049:  Protein of u  22.3   1E+02  0.0022   20.2   2.6   33   22-54      6-39  (68)
110 PF05915 DUF872:  Eukaryotic pr  22.3 1.5E+02  0.0032   22.8   3.8   27   34-60     39-65  (115)
111 PRK13415 flagella biosynthesis  22.3 1.6E+02  0.0035   25.4   4.5   23   24-48     60-82  (219)
112 PHA02337 putative high light i  22.3 1.9E+02  0.0041   18.5   3.7   23   33-56      3-25  (35)
113 PF12606 RELT:  Tumour necrosis  22.2 2.3E+02   0.005   19.2   4.3   22   46-67     10-31  (50)
114 TIGR02830 spore_III_AG stage I  22.0      77  0.0017   26.4   2.4   18   42-59      6-23  (186)
115 PF01490 Aa_trans:  Transmembra  22.0 1.1E+02  0.0023   25.7   3.3   25   34-58     24-48  (409)
116 COG4594 FecB ABC-type Fe3+-cit  21.7 1.5E+02  0.0033   26.9   4.3   20   41-60      6-25  (310)
117 PF06779 DUF1228:  Protein of u  21.4 1.6E+02  0.0035   21.5   3.7   15   45-59     62-76  (85)
118 PF03904 DUF334:  Domain of unk  21.0 1.1E+02  0.0025   26.6   3.3   23   34-56    147-170 (230)
119 PF01102 Glycophorin_A:  Glycop  20.9 1.6E+02  0.0034   23.1   3.8   30   36-65     69-98  (122)
120 PF10577 UPF0560:  Uncharacteri  20.8 1.2E+02  0.0026   30.9   3.8   25   34-58    272-296 (807)
121 PF03345 DDOST_48kD:  Oligosacc  20.8      41 0.00089   31.2   0.6   28   29-56    382-409 (423)
122 PHA03231 glycoprotein BALF4; P  20.8      80  0.0017   32.0   2.6   36   21-60    691-726 (829)
123 PF08693 SKG6:  Transmembrane a  20.8      77  0.0017   20.8   1.7   17   45-61     21-37  (40)
124 PF04961 FTCD_C:  Formiminotran  20.7 1.2E+02  0.0026   24.6   3.2   22   39-60     20-41  (184)
125 PF13623 SurA_N_2:  SurA N-term  20.7      89  0.0019   24.6   2.4   17   43-59     10-26  (145)
126 COG5042 NUP Purine nucleoside   20.5      52  0.0011   30.2   1.2   24   37-60     13-36  (349)
127 PF11239 DUF3040:  Protein of u  20.3 2.5E+02  0.0054   19.7   4.4   24   26-49     32-55  (82)
128 PF06387 Calcyon:  D1 dopamine   20.3      73  0.0016   27.1   2.0   14   45-58     85-98  (186)
129 PF04964 Flp_Fap:  Flp/Fap pili  20.1      92   0.002   20.2   2.0   14   42-55     14-27  (46)

No 1  
>PF07204 Orthoreo_P10:  Orthoreovirus membrane fusion protein p10;  InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction [].
Probab=88.80  E-value=0.26  Score=37.80  Aligned_cols=37  Identities=32%  Similarity=0.315  Sum_probs=31.1

Q ss_pred             CCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 042254           28 SPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKLSD   64 (159)
Q Consensus        28 s~W~SPvPYLFgGLA~MLgLIAvALLILACSy~K~ss   64 (159)
                      +..-+=.|||-+|=+++|.||-++|+.-.|.+||.+.
T Consensus        36 S~~~ayWpyLA~GGG~iLilIii~Lv~CC~~K~K~~~   72 (98)
T PF07204_consen   36 SSFVAYWPYLAAGGGLILILIIIALVCCCRAKHKTSA   72 (98)
T ss_pred             ehHHhhhHHhhccchhhhHHHHHHHHHHhhhhhhhHh
Confidence            5566678999999999999999998888888888654


No 2  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=85.83  E-value=1  Score=35.23  Aligned_cols=34  Identities=24%  Similarity=0.262  Sum_probs=24.8

Q ss_pred             CCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 042254           28 SPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        28 s~W~SPvPYLFgGLA~MLgLIAvALLILACSy~K~   62 (159)
                      .....|. .....|++|.|+|++.|||+-|-+|+.
T Consensus        59 h~fs~~~-i~~Ii~gv~aGvIg~Illi~y~irR~~   92 (122)
T PF01102_consen   59 HRFSEPA-IIGIIFGVMAGVIGIILLISYCIRRLR   92 (122)
T ss_dssp             SSSS-TC-HHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             cCccccc-eeehhHHHHHHHHHHHHHHHHHHHHHh
Confidence            4555565 455678999999999999988887643


No 3  
>TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type. CcoS from Rhodobacter capsulatus has been shown essential for incorporation of redox-active prosthetic groups (heme, Cu) into cytochrome cbb(3) oxidase. FixS of Bradyrhizobium japonicum appears to have the same function. Members of this family are found so far in organisms with a cbb3-type cytochrome oxidase, including Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Caulobacter crescentus, Bradyrhizobium japonicum, and Rhodobacter capsulatus.
Probab=82.52  E-value=3.1  Score=28.33  Aligned_cols=34  Identities=12%  Similarity=0.272  Sum_probs=23.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhhcccCCCCCccc
Q 042254           34 VPYLFGGLAAMLGLIAFALLILACSYWKLSDSRDIES   70 (159)
Q Consensus        34 vPYLFgGLA~MLgLIAvALLILACSy~K~ss~~d~e~   70 (159)
                      +-|+..+++++||+|+++.++.+   -|+..++|.|+
T Consensus         3 il~~LIpiSl~l~~~~l~~f~Wa---vk~GQfDDle~   36 (51)
T TIGR00847         3 ILTILIPISLLLGGVGLVAFLWS---LKSGQYDDLKG   36 (51)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHH---HccCCCCCCcc
Confidence            45888899999888887766655   24445555554


No 4  
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=80.64  E-value=3.5  Score=26.93  Aligned_cols=28  Identities=18%  Similarity=0.400  Sum_probs=22.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 042254           37 LFGGLAAMLGLIAFALLILACSYWKLSD   64 (159)
Q Consensus        37 LFgGLA~MLgLIAvALLILACSy~K~ss   64 (159)
                      ..+|..+-|.+|.+..++-+|-|+|...
T Consensus         8 IIv~V~vg~~iiii~~~~YaCcykk~~~   35 (38)
T PF02439_consen    8 IIVAVVVGMAIIIICMFYYACCYKKHRR   35 (38)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHccccc
Confidence            4567777888889999999999999654


No 5  
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=79.53  E-value=4.6  Score=26.68  Aligned_cols=34  Identities=32%  Similarity=0.510  Sum_probs=21.8

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhhcccCCCCCccc
Q 042254           34 VPYLFGGLAAMLGLIAFALLILACSYWKLSDSRDIES   70 (159)
Q Consensus        34 vPYLFgGLA~MLgLIAvALLILACSy~K~ss~~d~e~   70 (159)
                      +-|+..+++++||+++++.++.+  - |+..++|.|+
T Consensus         2 ~l~~lip~sl~l~~~~l~~f~Wa--v-k~GQfdD~e~   35 (45)
T PF03597_consen    2 ILYILIPVSLILGLIALAAFLWA--V-KSGQFDDLEG   35 (45)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHH--H-ccCCCCCCcc
Confidence            35788888888888777666654  2 3344445544


No 6  
>PF15347 PAG:  Phosphoprotein associated with glycosphingolipid-enriched
Probab=70.89  E-value=3.3  Score=38.63  Aligned_cols=24  Identities=38%  Similarity=0.692  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhh
Q 042254           36 YLFGGLAAMLGLIAFALLILACSY   59 (159)
Q Consensus        36 YLFgGLA~MLgLIAvALLILACSy   59 (159)
                      -|.|+||++-.++-|.+|||.||-
T Consensus        16 vlwgsLaav~~f~lis~LifLCsS   39 (428)
T PF15347_consen   16 VLWGSLAAVTTFLLISFLIFLCSS   39 (428)
T ss_pred             EeehHHHHHHHHHHHHHHHHHhhc
Confidence            366899999999999999999994


No 7  
>PRK13592 ubiA prenyltransferase; Provisional
Probab=66.36  E-value=7  Score=34.75  Aligned_cols=28  Identities=0%  Similarity=0.019  Sum_probs=22.8

Q ss_pred             CCChhHH-HHHHHHHHHHHHHHHHHHHhh
Q 042254           31 HSPVPYL-FGGLAAMLGLIAFALLILACS   58 (159)
Q Consensus        31 ~SPvPYL-FgGLA~MLgLIAvALLILACS   58 (159)
                      -||+||+ +|.++..+.+++.++++++|.
T Consensus       232 ~s~lp~~~~g~~g~~~l~~~~~~~l~~~~  260 (299)
T PRK13592        232 TNFALLWNISHVGVVVLVLNVIWMTVQFE  260 (299)
T ss_pred             HhhHHHHHhhhhHHHHHHHHHHHHHHHHH
Confidence            3789999 887777777788888888886


No 8  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=64.78  E-value=6.4  Score=29.75  Aligned_cols=11  Identities=27%  Similarity=0.377  Sum_probs=5.4

Q ss_pred             CCCCccccccC
Q 042254           97 DEKPTFLATPV  107 (159)
Q Consensus        97 De~PTfLA~P~  107 (159)
                      +--|.|=.++.
T Consensus        61 ~~~P~y~~~~~   71 (130)
T PF12273_consen   61 DYVPPYTETAN   71 (130)
T ss_pred             CCCCCCCCCCC
Confidence            44555555444


No 9  
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=64.73  E-value=6.5  Score=32.80  Aligned_cols=22  Identities=23%  Similarity=0.612  Sum_probs=18.6

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHH
Q 042254           34 VPYLFGGLAAMLGLIAFALLIL   55 (159)
Q Consensus        34 vPYLFgGLA~MLgLIAvALLIL   55 (159)
                      ..-+|||+.+.|||+||.+.++
T Consensus       160 ~~SFiGGIVL~LGv~aI~ff~~  181 (186)
T PF05283_consen  160 AASFIGGIVLTLGVLAIIFFLY  181 (186)
T ss_pred             hhhhhhHHHHHHHHHHHHHHHh
Confidence            3568999999999999988764


No 10 
>PF11174 DUF2970:  Protein of unknown function (DUF2970);  InterPro: IPR021344  This short family is conserved in Proteobacteria. The function is not known. 
Probab=63.73  E-value=11  Score=25.81  Aligned_cols=19  Identities=26%  Similarity=0.438  Sum_probs=14.2

Q ss_pred             CCChhHHHHHHHHHHHHHH
Q 042254           31 HSPVPYLFGGLAAMLGLIA   49 (159)
Q Consensus        31 ~SPvPYLFgGLA~MLgLIA   49 (159)
                      .+|.||++.|+.+.+.+|+
T Consensus        28 ~~p~~~Ii~gii~~~~fV~   46 (56)
T PF11174_consen   28 GSPVHFIIVGIILAALFVA   46 (56)
T ss_pred             CCCchHHHHHHHHHHHHHH
Confidence            4799999999876655543


No 11 
>TIGR00822 EII-Sor PTS system, mannose/fructose/sorbose family, IIC component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Man (PTS splinter group) family is unique in several respects among PTS permease families. It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this family can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the sorbose-specific IIC subunits of this family of PTS transporters.
Probab=57.95  E-value=27  Score=30.42  Aligned_cols=27  Identities=19%  Similarity=0.230  Sum_probs=19.1

Q ss_pred             ChhHHHHHHHHHHHH----HHHHHHHHHhhh
Q 042254           33 PVPYLFGGLAAMLGL----IAFALLILACSY   59 (159)
Q Consensus        33 PvPYLFgGLA~MLgL----IAvALLILACSy   59 (159)
                      =+||+|.|+.++--|    |++|++-+++.+
T Consensus       205 ~~~ff~lGF~laayl~l~~l~iAiig~~~A~  235 (265)
T TIGR00822       205 LMPFFYLGFLFAAYTDFSLLAFGAVGGAGAL  235 (265)
T ss_pred             hHHHHHHHHHHHHHhCCcHHHHHHHHHHHHH
Confidence            479999999876443    677766665554


No 12 
>PHA03283 envelope glycoprotein E; Provisional
Probab=57.87  E-value=12  Score=36.07  Aligned_cols=31  Identities=16%  Similarity=0.492  Sum_probs=24.6

Q ss_pred             CCCCCChhH--HHHHHHHHHHHHHHHHHHHHhhhc
Q 042254           28 SPWHSPVPY--LFGGLAAMLGLIAFALLILACSYW   60 (159)
Q Consensus        28 s~W~SPvPY--LFgGLA~MLgLIAvALLILACSy~   60 (159)
                      ..|-  -+|  +++||.+.+||+.++|++-+|-+.
T Consensus       393 ~~~~--~~~l~~~~~~~~~~~~~~~~l~vw~c~~~  425 (542)
T PHA03283        393 GAWT--RHYLAFLLAIICTCAALLVALVVWGCILY  425 (542)
T ss_pred             Cccc--cccchhHHHHHHHHHHHHHHHhhhheeee
Confidence            3553  455  588889999999999999999873


No 13 
>PF05151 PsbM:  Photosystem II reaction centre M protein (PsbM);  InterPro: IPR007826 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbM found in PSII. PsbM is one of the most hydrophobic proteins in the thylakoid membrane. The function of this protein is unknown.; GO: 0015979 photosynthesis, 0019684 photosynthesis, light reaction, 0009523 photosystem II, 0016021 integral to membrane; PDB: 3A0H_m 3ARC_m 3A0B_M 3PRR_M 3PRQ_M 1S5L_M 4FBY_e 3BZ2_M 3BZ1_M 2AXT_M ....
Probab=57.08  E-value=8.8  Score=24.12  Aligned_cols=14  Identities=50%  Similarity=0.588  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHhh
Q 042254           45 LGLIAFALLILACS   58 (159)
Q Consensus        45 LgLIAvALLILACS   58 (159)
                      +|+||.||.||.++
T Consensus         6 l~fiAtaLfi~iPt   19 (31)
T PF05151_consen    6 LAFIATALFILIPT   19 (31)
T ss_dssp             THHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHH
Confidence            67888888888765


No 14 
>PF10215 Ost4:  Oligosaccaryltransferase  ;  InterPro: IPR018943  Ost4 is a very short, approximately 30 residues, enzyme found from fungi to vertebrates. It is a member of the ER oligosaccaryltansferase complex, 2.4.1.119 from EC, that catalyses the asparagine-linked glycosylation of proteins. It appears to be an integral membrane protein that mediates the en bloc transfer of a pre-assembled high-mannose oligosaccharide onto asparagine residues of nascent polypeptides as they enter the lumen of the rough endoplasmic reticulum. ; PDB: 1RKL_A 2LAT_A.
Probab=55.91  E-value=18  Score=22.99  Aligned_cols=18  Identities=39%  Similarity=0.634  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 042254           38 FGGLAAMLGLIAFALLIL   55 (159)
Q Consensus        38 FgGLA~MLgLIAvALLIL   55 (159)
                      ...||..||+.++.|+||
T Consensus         7 L~~lan~lG~~~~~LIVl   24 (35)
T PF10215_consen    7 LYTLANFLGVAAMVLIVL   24 (35)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            356888899999988886


No 15 
>PF09928 DUF2160:  Predicted small integral membrane protein (DUF2160);  InterPro: IPR018678  The members of this family of hypothetical prokaryotic proteins have no known function. It is thought that they are transmembrane proteins, but their function has not been inferred yet. 
Probab=55.47  E-value=12  Score=28.23  Aligned_cols=22  Identities=27%  Similarity=0.489  Sum_probs=18.8

Q ss_pred             CCCCChhHHHHHHHHHHHHHHH
Q 042254           29 PWHSPVPYLFGGLAAMLGLIAF   50 (159)
Q Consensus        29 ~W~SPvPYLFgGLA~MLgLIAv   50 (159)
                      -|..|+--+|+++++||+..++
T Consensus         3 aWT~ptA~FF~~I~~~L~~mtv   24 (88)
T PF09928_consen    3 AWTWPTAIFFICIALMLAGMTV   24 (88)
T ss_pred             CcchHHHHHHHHHHHHHHHHHH
Confidence            4899999999999999877654


No 16 
>PRK13726 conjugal transfer pilus assembly protein TraE; Provisional
Probab=55.24  E-value=38  Score=27.95  Aligned_cols=34  Identities=18%  Similarity=0.175  Sum_probs=26.5

Q ss_pred             CCChhHH---HHHHHHHHHHHHHHHHHHHhhhcccCC
Q 042254           31 HSPVPYL---FGGLAAMLGLIAFALLILACSYWKLSD   64 (159)
Q Consensus        31 ~SPvPYL---FgGLA~MLgLIAvALLILACSy~K~ss   64 (159)
                      +|-.=|+   |.+|+..+.|+.++.++|+|+-|+...
T Consensus         7 ~~~~~~~~~~~~~l~~l~~~~~~~~v~l~~~~~~~~~   43 (188)
T PRK13726          7 LSTSRVMAIAFIFLSVLIVLSLSVNVIQGVNNYRLQN   43 (188)
T ss_pred             ccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            3344455   888888888899999999999988654


No 17 
>PHA02909 hypothetical protein; Provisional
Probab=54.72  E-value=13  Score=26.79  Aligned_cols=9  Identities=67%  Similarity=1.110  Sum_probs=6.9

Q ss_pred             HHHHHhhhc
Q 042254           52 LLILACSYW   60 (159)
Q Consensus        52 LLILACSy~   60 (159)
                      ..||||||-
T Consensus        49 ftilacsyv   57 (72)
T PHA02909         49 FTILACSYV   57 (72)
T ss_pred             HHHHHHHHH
Confidence            358999985


No 18 
>PF13295 DUF4077:  Domain of unknown function (DUF4077)
Probab=52.94  E-value=5.4  Score=32.67  Aligned_cols=29  Identities=38%  Similarity=0.720  Sum_probs=24.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 042254           34 VPYLFGGLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        34 vPYLFgGLA~MLgLIAvALLILACSy~K~   62 (159)
                      .-||---|.++||-+|+.|..+.||||..
T Consensus       112 liylserlvvilggvavvltfilcsywpe  140 (175)
T PF13295_consen  112 LIYLSERLVVILGGVAVVLTFILCSYWPE  140 (175)
T ss_pred             HHHHHhHHHHhcccchheeehhhhhcChH
Confidence            34666778889999999999999999963


No 19 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=52.80  E-value=15  Score=23.46  Aligned_cols=15  Identities=40%  Similarity=0.769  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHHHh
Q 042254           43 AMLGLIAFALLILAC   57 (159)
Q Consensus        43 ~MLgLIAvALLILAC   57 (159)
                      +|+|+|-+.+++|.|
T Consensus        18 a~~gl~il~~~vl~a   32 (56)
T PF12911_consen   18 AVIGLIILLILVLLA   32 (56)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344444444444443


No 20 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=52.70  E-value=2.4  Score=33.58  Aligned_cols=21  Identities=29%  Similarity=0.426  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHhhhc-ccCCCC
Q 042254           46 GLIAFALLILACSYW-KLSDSR   66 (159)
Q Consensus        46 gLIAvALLILACSy~-K~ss~~   66 (159)
                      .||-..||||-|-|. |+|+|.
T Consensus        33 ~VILgiLLliGCWYckRRSGYk   54 (118)
T PF14991_consen   33 IVILGILLLIGCWYCKRRSGYK   54 (118)
T ss_dssp             ----------------------
T ss_pred             HHHHHHHHHHhheeeeecchhh
Confidence            344445666666665 556664


No 21 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=52.65  E-value=4.6  Score=37.14  Aligned_cols=36  Identities=17%  Similarity=0.319  Sum_probs=0.0

Q ss_pred             CCCCCCCChhHHHHHH-HHHHHHHHHHHHHHHhhhcc
Q 042254           26 QRSPWHSPVPYLFGGL-AAMLGLIAFALLILACSYWK   61 (159)
Q Consensus        26 ~~s~W~SPvPYLFgGL-A~MLgLIAvALLILACSy~K   61 (159)
                      +...|.++.-.+++++ ++.++|+.+.++++.|.++|
T Consensus       343 ~p~~~~~~~~~~l~vVlgvavlivVv~viv~vc~~~r  379 (439)
T PF02480_consen  343 PPSPRTSRGAALLGVVLGVAVLIVVVGVIVWVCLRCR  379 (439)
T ss_dssp             -------------------------------------
T ss_pred             CCCCCCCcccchHHHHHHHHHHHHHHHHHhheeeeeh
Confidence            3455666666555555 23333333333444444443


No 22 
>PRK14094 psbM photosystem II reaction center protein M; Provisional
Probab=51.90  E-value=21  Score=24.61  Aligned_cols=15  Identities=20%  Similarity=0.292  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHhh
Q 042254           44 MLGLIAFALLILACS   58 (159)
Q Consensus        44 MLgLIAvALLILACS   58 (159)
                      .||+||.+|.|+.=+
T Consensus         5 ~lgfiAtaLFi~iPT   19 (50)
T PRK14094          5 NFGFVASLLFVGVPT   19 (50)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            467777777766544


No 23 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=51.69  E-value=7  Score=29.54  Aligned_cols=12  Identities=25%  Similarity=0.503  Sum_probs=4.7

Q ss_pred             HHHHHHHHHHHh
Q 042254           46 GLIAFALLILAC   57 (159)
Q Consensus        46 gLIAvALLILAC   57 (159)
                      ++|.|.|+++.|
T Consensus        10 ~~i~l~~~~~~~   21 (130)
T PF12273_consen   10 VAILLFLFLFYC   21 (130)
T ss_pred             HHHHHHHHHHHH
Confidence            333333334444


No 24 
>PF15339 Afaf:  Acrosome formation-associated factor
Probab=51.51  E-value=19  Score=30.70  Aligned_cols=23  Identities=22%  Similarity=0.287  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhh
Q 042254           36 YLFGGLAAMLGLIAFALLILACS   58 (159)
Q Consensus        36 YLFgGLA~MLgLIAvALLILACS   58 (159)
                      =|.+|+.+|-.||-|.||++.|.
T Consensus       131 kLmLGIsLmTl~lfv~Ll~~c~a  153 (200)
T PF15339_consen  131 KLMLGISLMTLFLFVILLAFCSA  153 (200)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            48999999999999999998886


No 25 
>PF01998 DUF131:  Protein of unknown function DUF131;  InterPro: IPR002849 This archaebacterial protein family has no known function. The proteins are predicted to contain two transmembrane helices.
Probab=49.09  E-value=7  Score=27.59  Aligned_cols=24  Identities=42%  Similarity=0.852  Sum_probs=14.7

Q ss_pred             ChhHHHHH---HHHHHHHHHHHHHHHH
Q 042254           33 PVPYLFGG---LAAMLGLIAFALLILA   56 (159)
Q Consensus        33 PvPYLFgG---LA~MLgLIAvALLILA   56 (159)
                      |+|..||.   ++..+.++|+.|+++.
T Consensus        33 PIPIvFGs~~~~~~~~~ilaiil~i~~   59 (64)
T PF01998_consen   33 PIPIVFGSSPRIAKIAMILAIILMILA   59 (64)
T ss_pred             cccEEEcCCHHHHHHHHHHHHHHHHHH
Confidence            78888885   4444555555555543


No 26 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=48.53  E-value=17  Score=31.64  Aligned_cols=19  Identities=37%  Similarity=0.732  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHhhh
Q 042254           41 LAAMLGLIAFALLILACSY   59 (159)
Q Consensus        41 LA~MLgLIAvALLILACSy   59 (159)
                      +|..+.||-+|.|+|.|..
T Consensus       128 ~amLIClIIIAVLfLICT~  146 (227)
T PF05399_consen  128 MAMLICLIIIAVLFLICTL  146 (227)
T ss_pred             hhHHHHHHHHHHHHHHHHH
Confidence            5677889999999999984


No 27 
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily. Members of this protein family belong to the family of polysaccharide chain length determinant proteins (pfam02706). All are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria, and are found near the epsH homolog that is the putative exosortase gene.
Probab=46.70  E-value=44  Score=29.78  Aligned_cols=38  Identities=21%  Similarity=-0.003  Sum_probs=28.3

Q ss_pred             cCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhcccC
Q 042254           25 QQRSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        25 ~~~s~W~SPvPYLFgGLA~MLgLIAvALLILACSy~K~s   63 (159)
                      .|..++. |-+-++.++++|+|++.-..+++.+.++..+
T Consensus       404 ~P~~P~~-P~~~~~l~~g~~~Gl~lg~~~~~l~e~ld~~  441 (498)
T TIGR03007       404 VPSKPSG-PNRPLLMLAGLLGGLGAGIGLAFLLSQLRPT  441 (498)
T ss_pred             CCCCCCC-CcHHHHHHHHHHHHHHHHHHHHHHHHHhcCc
Confidence            3444554 7777888899999998888888888877544


No 28 
>PF14241 DUF4341:  Domain of unknown function (DUF4341)
Probab=46.59  E-value=30  Score=23.71  Aligned_cols=22  Identities=50%  Similarity=0.841  Sum_probs=15.3

Q ss_pred             CChhHHHHHHHHHHHHHHHHHHHH
Q 042254           32 SPVPYLFGGLAAMLGLIAFALLIL   55 (159)
Q Consensus        32 SPvPYLFgGLA~MLgLIAvALLIL   55 (159)
                      ||.+.++||+  |+|+-++.|+.+
T Consensus         1 Tp~~~l~GG~--lIGla~~~ll~~   22 (62)
T PF14241_consen    1 TPWSALIGGL--LIGLAASLLLLL   22 (62)
T ss_pred             CccHHHHHHH--HHHHHHHHHHHH
Confidence            6888999985  566666655554


No 29 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=46.19  E-value=17  Score=31.09  Aligned_cols=29  Identities=24%  Similarity=0.296  Sum_probs=18.9

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 042254           34 VPYLFGGLAAMLGLIAFALLILACSYWKLSD   64 (159)
Q Consensus        34 vPYLFgGLA~MLgLIAvALLILACSy~K~ss   64 (159)
                      +|.. .|+++ .|||.+.|+.-.|.|||.+.
T Consensus       273 vPIa-VG~~L-a~lvlivLiaYli~Rrr~~~  301 (306)
T PF01299_consen  273 VPIA-VGAAL-AGLVLIVLIAYLIGRRRSRA  301 (306)
T ss_pred             HHHH-HHHHH-HHHHHHHHHhheeEeccccc
Confidence            4443 55444 66777778887888877654


No 30 
>PRK09757 PTS system N-acetylgalactosamine-specific transporter subunit IIC; Provisional
Probab=45.84  E-value=27  Score=30.35  Aligned_cols=28  Identities=25%  Similarity=0.511  Sum_probs=20.1

Q ss_pred             ChhHHHHHHHHH--HH---HHHHHHHHHHhhhc
Q 042254           33 PVPYLFGGLAAM--LG---LIAFALLILACSYW   60 (159)
Q Consensus        33 PvPYLFgGLA~M--Lg---LIAvALLILACSy~   60 (159)
                      =.||+|.|+.++  ++   +|++|++-++|.+.
T Consensus       206 ~~~ff~lGF~l~ayl~~~~~i~iaiig~~iA~~  238 (267)
T PRK09757        206 YIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVY  238 (267)
T ss_pred             hHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHH
Confidence            479999998764  33   57888777777654


No 31 
>PRK15065 PTS system mannose-specific transporter subunit IIC; Provisional
Probab=44.20  E-value=55  Score=28.48  Aligned_cols=27  Identities=15%  Similarity=0.301  Sum_probs=20.0

Q ss_pred             ChhHHHHHHHHHHHH----HHHHHHHHHhhh
Q 042254           33 PVPYLFGGLAAMLGL----IAFALLILACSY   59 (159)
Q Consensus        33 PvPYLFgGLA~MLgL----IAvALLILACSy   59 (159)
                      =.||+|.|+.++--|    |++|++-+++.+
T Consensus       206 ~~~ff~lGFvl~ayl~l~~l~iAiig~~iA~  236 (262)
T PRK15065        206 LMPFFYLGFVLAAFTNLNLIALGVIGVVLAL  236 (262)
T ss_pred             hHHHHHHHHHHHHHhCCcHHHHHHHHHHHHH
Confidence            479999999876444    777777666665


No 32 
>PRK05419 putative sulfite oxidase subunit YedZ; Reviewed
Probab=43.67  E-value=28  Score=28.82  Aligned_cols=30  Identities=37%  Similarity=0.468  Sum_probs=26.6

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 042254           33 PVPYLFGGLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        33 PvPYLFgGLA~MLgLIAvALLILACSy~K~   62 (159)
                      ..||+..|+.+++.|+.+|+.-.-+..+|.
T Consensus       113 ~~~~i~~G~ia~~lLl~LaiTS~~~~~rrL  142 (205)
T PRK05419        113 KRPYITVGMAAFLILLPLALTSTRASQRRL  142 (205)
T ss_pred             hchHHHHHHHHHHHHHHHHHHhhHHHHHHH
Confidence            478999999999999999999998887765


No 33 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=43.38  E-value=23  Score=25.09  Aligned_cols=23  Identities=13%  Similarity=0.307  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHHHHHhhhccc
Q 042254           40 GLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        40 GLA~MLgLIAvALLILACSy~K~   62 (159)
                      -++.++.|+++.++++.|.+++.
T Consensus         6 ~~~g~~~ll~~v~~~~~~~rr~~   28 (75)
T PF14575_consen    6 IIVGVLLLLVLVIIVIVCFRRCK   28 (75)
T ss_dssp             HHHHHHHHHHHHHHHHCCCTT--
T ss_pred             HHHHHHHHHHhheeEEEEEeeEc
Confidence            34445555666666777776654


No 34 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=42.78  E-value=8.1  Score=35.56  Aligned_cols=45  Identities=9%  Similarity=0.094  Sum_probs=0.0

Q ss_pred             hcccccCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhcccCC
Q 042254           20 ATVATQQRSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKLSD   64 (159)
Q Consensus        20 ~~~~~~~~s~W~SPvPYLFgGLA~MLgLIAvALLILACSy~K~ss   64 (159)
                      .++.......|..-+-.++|++++++.++.++++++.|.++|...
T Consensus       341 ~~~p~~~~~~~~~~l~vVlgvavlivVv~viv~vc~~~rrrR~~~  385 (439)
T PF02480_consen  341 PAPPSPRTSRGAALLGVVLGVAVLIVVVGVIVWVCLRCRRRRRQR  385 (439)
T ss_dssp             ---------------------------------------------
T ss_pred             CCCCCCCCCcccchHHHHHHHHHHHHHHHHHhheeeeehhccccc
Confidence            344567889999999999999999999999999999999998644


No 35 
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=42.61  E-value=21  Score=24.41  Aligned_cols=11  Identities=27%  Similarity=0.093  Sum_probs=6.3

Q ss_pred             ccCccEEEEec
Q 042254           85 VYEEKILVIMA   95 (159)
Q Consensus        85 ~~EpKIvVIMA   95 (159)
                      +.++.|.||+|
T Consensus        61 ~~~~~vAaI~A   71 (79)
T PF04277_consen   61 DDPELVAAIAA   71 (79)
T ss_pred             CChHHHHHHHH
Confidence            45555656654


No 36 
>COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism]
Probab=42.47  E-value=33  Score=24.23  Aligned_cols=33  Identities=15%  Similarity=0.345  Sum_probs=18.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhhcccCCCCCccc
Q 042254           35 PYLFGGLAAMLGLIAFALLILACSYWKLSDSRDIES   70 (159)
Q Consensus        35 PYLFgGLA~MLgLIAvALLILACSy~K~ss~~d~e~   70 (159)
                      -|+...++++||.|++.-  +-|+- |+..++|+++
T Consensus         4 l~~Lipvsi~l~~v~l~~--flWav-ksgQyDDl~g   36 (58)
T COG3197           4 LYILIPVSILLGAVGLGA--FLWAV-KSGQYDDLDG   36 (58)
T ss_pred             eeeHHHHHHHHHHHHHHH--HHHhc-ccCCcccccc
Confidence            467777887777655433  33332 5555656554


No 37 
>CHL00080 psbM photosystem II protein M
Probab=42.27  E-value=25  Score=22.54  Aligned_cols=15  Identities=47%  Similarity=0.625  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHhh
Q 042254           44 MLGLIAFALLILACS   58 (159)
Q Consensus        44 MLgLIAvALLILACS   58 (159)
                      .||+||.+|.|+.=+
T Consensus         5 ~lgfiAt~LFi~iPt   19 (34)
T CHL00080          5 ILAFIATALFILVPT   19 (34)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            467777777776543


No 38 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=41.40  E-value=35  Score=27.27  Aligned_cols=28  Identities=29%  Similarity=0.496  Sum_probs=21.7

Q ss_pred             CCCCCCChhHHHHHHHHHHHHHHHHHHHHHhh
Q 042254           27 RSPWHSPVPYLFGGLAAMLGLIAFALLILACS   58 (159)
Q Consensus        27 ~s~W~SPvPYLFgGLA~MLgLIAvALLILACS   58 (159)
                      ..+||    |-+.+|+++..+|.|.||...-.
T Consensus        32 ~tpWN----ysiL~Ls~vvlvi~~~LLgrsi~   59 (125)
T PF15048_consen   32 ATPWN----YSILALSFVVLVISFFLLGRSIQ   59 (125)
T ss_pred             CCCcc----hHHHHHHHHHHHHHHHHHHHHhH
Confidence            44555    99999999999999988866543


No 39 
>PF09049 SNN_transmemb:  Stannin transmembrane;  InterPro: IPR015135 This region consists of a single highly hydrophobic transmembrane helix that transverses the lipid bilayer at a 20 degree angle with respect to the membrane normal. It contains a conserved cysteine residue (Cys32) that, together with Cys34 found in the stannin unstructured linker domain, constitutes the putative trimethyltin-binding site that resides at the end of the transmembrane domain close to the lipid/solvent interface []. ; PDB: 1ZZA_A.
Probab=41.13  E-value=82  Score=20.01  Aligned_cols=27  Identities=44%  Similarity=0.754  Sum_probs=15.6

Q ss_pred             CCChhHHHHHHHHHHHHHHHH-HHHHHhhhc
Q 042254           31 HSPVPYLFGGLAAMLGLIAFA-LLILACSYW   60 (159)
Q Consensus        31 ~SPvPYLFgGLA~MLgLIAvA-LLILACSy~   60 (159)
                      |||+-   |-.-+..-|||+| |-+|.|-.|
T Consensus         6 hsptt---gvvti~viliavaalg~licgcw   33 (33)
T PF09049_consen    6 HSPTT---GVVTIIVILIAVAALGALICGCW   33 (33)
T ss_dssp             TTTHH---HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCc---cEEEehhHHHHHHHHhhhheecC
Confidence            56653   3344556667775 446667655


No 40 
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=40.33  E-value=33  Score=27.34  Aligned_cols=22  Identities=32%  Similarity=0.434  Sum_probs=14.5

Q ss_pred             ccCccEEEEecCCCC--CccccccC
Q 042254           85 VYEEKILVIMAGDEK--PTFLATPV  107 (159)
Q Consensus        85 ~~EpKIvVIMAGDe~--PTfLA~P~  107 (159)
                      ..++ |+|=+++++.  ..||---+
T Consensus        70 ~l~~-fvVNL~~~~~~~~ryLkv~i   93 (166)
T PRK12785         70 DVPD-MLVNLAGDPGERVQYLKLKV   93 (166)
T ss_pred             EcCC-EEEECCCCCCCcceEEEEEE
Confidence            3444 8899987653  68876544


No 41 
>TIGR03038 PS_II_psbM photosystem II reaction center protein PsbM. Members of this protein family are the photosystem II reaction center M protein, product of the psbM gene, in Cyanobacteria and their derived organelles in plants. This model resembles Pfam model pfam05151 but has cutoffs set to avoid false-positive matches to similar (not necessarily homologous) sequences in species that are not photosynthetic.
Probab=40.09  E-value=29  Score=22.14  Aligned_cols=13  Identities=54%  Similarity=0.825  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHHHH
Q 042254           44 MLGLIAFALLILA   56 (159)
Q Consensus        44 MLgLIAvALLILA   56 (159)
                      .+|+||.+|.|+.
T Consensus         5 ~l~fiAt~Lfi~i   17 (33)
T TIGR03038         5 ILGFIATLLFILV   17 (33)
T ss_pred             HHHHHHHHHHHHH
Confidence            3567777776665


No 42 
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion]
Probab=39.81  E-value=29  Score=27.66  Aligned_cols=20  Identities=35%  Similarity=0.491  Sum_probs=17.5

Q ss_pred             HHHHHHHHHHHHHHHHHHhh
Q 042254           39 GGLAAMLGLIAFALLILACS   58 (159)
Q Consensus        39 gGLA~MLgLIAvALLILACS   58 (159)
                      |..|+|++||+.-||+|.+-
T Consensus        21 Ga~AVeFAlvap~ll~l~~g   40 (185)
T COG4961          21 GAAAVEFALVAPPLLLLVFG   40 (185)
T ss_pred             chHHHHHHHHHHHHHHHHHH
Confidence            57889999999999999886


No 43 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=39.07  E-value=40  Score=28.32  Aligned_cols=23  Identities=30%  Similarity=0.430  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHhhhcccC
Q 042254           41 LAAMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        41 LA~MLgLIAvALLILACSy~K~s   63 (159)
                      +++.+-+|.+-+||..||.||..
T Consensus        36 iaIvVliiiiivli~lcssRKkK   58 (189)
T PF05568_consen   36 IAIVVLIIIIIVLIYLCSSRKKK   58 (189)
T ss_pred             HHHHHHHHHHHHHHHHHhhhhHH
Confidence            34444456667788889988754


No 44 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=38.97  E-value=29  Score=25.92  Aligned_cols=21  Identities=38%  Similarity=0.586  Sum_probs=15.9

Q ss_pred             HHHHHHHHHHHHHHhhhcccC
Q 042254           43 AMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        43 ~MLgLIAvALLILACSy~K~s   63 (159)
                      +++|+++|.++|+++-|||.-
T Consensus         6 iv~~~~~v~~~i~~y~~~k~~   26 (87)
T PF10883_consen    6 IVGGVGAVVALILAYLWWKVK   26 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            345778888888888888854


No 45 
>PF06596 PsbX:  Photosystem II reaction centre X protein (PsbX);  InterPro: IPR009518 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  The low molecular weight transmembrane protein PsbX found in PSII is associated with the oxygen-evolving complex. Its expression is light-regulated. PsbX appears to be involved in the regulation of the amount of PSII [], and may be involved in the binding or turnover of quinone molecules at the Qb (PsbA) site [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0016020 membrane; PDB: 3ARC_x 3A0H_X 3A0B_X 3PRR_X 1S5L_x 4FBY_j 3PRQ_X 3KZI_X 3BZ2_X 3BZ1_X.
Probab=37.49  E-value=56  Score=21.41  Aligned_cols=20  Identities=30%  Similarity=0.338  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 042254           37 LFGGLAAMLGLIAFALLILA   56 (159)
Q Consensus        37 LFgGLA~MLgLIAvALLILA   56 (159)
                      |+.|..+.++.|++||+...
T Consensus        12 l~aG~~iVv~~i~~ali~VS   31 (39)
T PF06596_consen   12 LVAGAVIVVIPIAGALIFVS   31 (39)
T ss_dssp             HHHHH-HHHHHHHHHHHHHH
T ss_pred             HHhhhhhhhhhhhhheEEEe
Confidence            56677788888999888764


No 46 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=37.48  E-value=55  Score=23.02  Aligned_cols=27  Identities=33%  Similarity=0.657  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccC
Q 042254           37 LFGGLAAMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        37 LFgGLA~MLgLIAvALLILACSy~K~s   63 (159)
                      .+-|.+--.|||++.|+.++|-||-.+
T Consensus         5 ~~~~~a~a~~t~~~~l~fiavi~~ayr   31 (60)
T COG4736           5 MMRGFADAWGTIAFTLFFIAVIYFAYR   31 (60)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            456778888999999999998876543


No 47 
>PF11980 DUF3481:  Domain of unknown function (DUF3481);  InterPro: IPR022579  This domain of unknown function is located in the C terminus of the eukaryotic neuropilin receptor family of proteins. It is found in association with PF00754 from PFAM, PF00431 from PFAM and PF00629 from PFAM. There are two completely conserved residues (Y and E) that may be functionally important.
Probab=37.08  E-value=38  Score=25.65  Aligned_cols=25  Identities=32%  Similarity=0.497  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHHHH-HHHhhhc
Q 042254           36 YLFGGLAAMLGLIAFALL-ILACSYW   60 (159)
Q Consensus        36 YLFgGLA~MLgLIAvALL-ILACSy~   60 (159)
                      |++.|=++.|.|++|+|. +|-|-++
T Consensus        18 yiiA~gga~llL~~v~l~vvL~C~r~   43 (87)
T PF11980_consen   18 YIIAMGGALLLLVAVCLGVVLYCHRF   43 (87)
T ss_pred             HHHhhccHHHHHHHHHHHHHHhhhhh
Confidence            667777777777777744 4444443


No 48 
>PRK04989 psbM photosystem II reaction center protein M; Provisional
Probab=36.96  E-value=34  Score=22.08  Aligned_cols=15  Identities=33%  Similarity=0.505  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHHHHhh
Q 042254           44 MLGLIAFALLILACS   58 (159)
Q Consensus        44 MLgLIAvALLILACS   58 (159)
                      .||+||.+|.|+.=+
T Consensus         5 ~lgfiAt~Lfi~iPt   19 (35)
T PRK04989          5 DLGFVASLLFVLVPT   19 (35)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            356677776665533


No 49 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=36.80  E-value=48  Score=25.25  Aligned_cols=27  Identities=30%  Similarity=0.340  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhcccC
Q 042254           37 LFGGLAAMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        37 LFgGLA~MLgLIAvALLILACSy~K~s   63 (159)
                      ++.++-++|.||.|+.-||+|-..|+.
T Consensus         2 ~Ll~il~llLll~l~asl~~wr~~~rq   28 (107)
T PF15330_consen    2 LLLGILALLLLLSLAASLLAWRMKQRQ   28 (107)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            344555556677788888888766543


No 50 
>PF03916 NrfD:  Polysulphide reductase, NrfD;  InterPro: IPR005614 NrfD is an integral transmembrane protein with loops in both the periplasm and the cytoplasm. NrfD is thought to participate in the transfer of electrons, from the quinone pool into the terminal components of the Nrf pathway [].
Probab=36.75  E-value=40  Score=28.37  Aligned_cols=23  Identities=39%  Similarity=0.589  Sum_probs=16.8

Q ss_pred             cCCCCCCCCh-hHHHHHHHHHHHH
Q 042254           25 QQRSPWHSPV-PYLFGGLAAMLGL   47 (159)
Q Consensus        25 ~~~s~W~SPv-PYLFgGLA~MLgL   47 (159)
                      ..+..||||. |.+|.--|+.-|+
T Consensus       165 ~~~p~W~s~~lp~lFl~sAl~sG~  188 (313)
T PF03916_consen  165 KARPLWNSPLLPPLFLVSALASGA  188 (313)
T ss_pred             hcchhHhhhhHHHHHHHHHHHHHH
Confidence            4677899984 7777777766665


No 51 
>PF13807 GNVR:  G-rich domain on putative tyrosine kinase
Probab=36.71  E-value=65  Score=22.32  Aligned_cols=20  Identities=40%  Similarity=0.355  Sum_probs=15.3

Q ss_pred             CCChhHHHHHHHHHHHHHHH
Q 042254           31 HSPVPYLFGGLAAMLGLIAF   50 (159)
Q Consensus        31 ~SPvPYLFgGLA~MLgLIAv   50 (159)
                      .+|-.-++..+|+++||+.=
T Consensus        54 ~~P~~~lil~l~~~~Gl~lg   73 (82)
T PF13807_consen   54 VSPKRALILALGLFLGLILG   73 (82)
T ss_pred             CCCcHHHHHHHHHHHHHHHH
Confidence            46777888889999988543


No 52 
>PF05255 UPF0220:  Uncharacterised protein family (UPF0220);  InterPro: IPR007919 This family of proteins is functionally uncharacterised.
Probab=36.04  E-value=44  Score=27.18  Aligned_cols=28  Identities=29%  Similarity=0.349  Sum_probs=23.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 042254           35 PYLFGGLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        35 PYLFgGLA~MLgLIAvALLILACSy~K~   62 (159)
                      -.||.|+++|.|=++-|+.||.=-|-..
T Consensus       101 ~~LFigf~l~fggl~~s~~vli~~yv~~  128 (166)
T PF05255_consen  101 LWLFIGFALSFGGLAGSVWVLILKYVVP  128 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhcccccC
Confidence            3799999999999999999998666543


No 53 
>COG3190 FliO Flagellar biogenesis protein [Cell motility and secretion]
Probab=35.34  E-value=93  Score=25.10  Aligned_cols=61  Identities=26%  Similarity=0.370  Sum_probs=30.4

Q ss_pred             CChhHHHHHHHHHHHHHHHHHHHHHhhhcccCCCCCcccCCCCCCCcccCCccccCccEEEEecCCC
Q 042254           32 SPVPYLFGGLAAMLGLIAFALLILACSYWKLSDSRDIESGDKGQEGDAANSVKVYEEKILVIMAGDE   98 (159)
Q Consensus        32 SPvPYLFgGLA~MLgLIAvALLILACSy~K~ss~~d~e~~~~~~~~~~~~~~~~~EpKIvVIMAGDe   98 (159)
                      ...-.+||+|.++|+||-+    ++|-.+|..... .-.+...= +--+..++--.++|+||=.||.
T Consensus        22 ~~~~~~~gsL~~iL~lil~----~~wl~kr~~~~~-~~~~~~~l-kil~~~~lG~resV~lV~V~~~   82 (137)
T COG3190          22 LELAQMFGSLILILALILF----LAWLVKRLGRAP-LFKGSSGL-KILASRSLGSRESVVLVEVGDK   82 (137)
T ss_pred             hHHHHHHHHHHHHHHHHHH----HHHHHHHHhhcc-cCCcccce-eeecccccCCCceEEEEEECCE
Confidence            3477889999888888744    344444543210 00000000 0001233445677777777773


No 54 
>PLN00085 photosystem II reaction center protein M (PsbM); Provisional
Probab=34.81  E-value=44  Score=27.22  Aligned_cols=22  Identities=41%  Similarity=0.606  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHHHhh------hcccCCC
Q 042254           44 MLGLIAFALLILACS------YWKLSDS   65 (159)
Q Consensus        44 MLgLIAvALLILACS------y~K~ss~   65 (159)
                      .||+||.+|.||.=+      |-|..+.
T Consensus        82 iLgfIAtaLFIlIPTaFLLILYVkTaS~  109 (149)
T PLN00085         82 ILGVIATALFIIIPTSFLIILYVKSASE  109 (149)
T ss_pred             HHHHHHHHHHHHHHHHHHHHheeeeccc
Confidence            589999999887755      6665544


No 55 
>COG5416 Uncharacterized integral membrane protein [Function unknown]
Probab=33.86  E-value=58  Score=25.15  Aligned_cols=35  Identities=23%  Similarity=0.194  Sum_probs=26.7

Q ss_pred             cccccCCCCCCCChhHHHHHHHHHHHHHHHHHHHH
Q 042254           21 TVATQQRSPWHSPVPYLFGGLAAMLGLIAFALLIL   55 (159)
Q Consensus        21 ~~~~~~~s~W~SPvPYLFgGLA~MLgLIAvALLIL   55 (159)
                      ....-.+|.|+=|.=-.+.|-++|=+||++.+.+-
T Consensus        48 V~~~~lfg~~~~PLilvil~s~v~G~Li~~~~~~~   82 (98)
T COG5416          48 VEFNYLFGQWELPLILVILGAAVVGALIAMFAGIA   82 (98)
T ss_pred             eEEEeecchhhhhHHHHHHHHHHHHHHHHHHHhHH
Confidence            34445778899898888888888888888776653


No 56 
>cd02435 CCC1 CCC1. CCC1: This domain is present in the CCC1, an iron and manganese transporter of Saccharomyces cerevisiae. CCC1 is a transmembrane protein that is located in the vacuole and transfers the iron and manganese ions from the cytosol to the vacuole. This domain may be unique to certain fungi and plants.
Probab=33.63  E-value=59  Score=27.59  Aligned_cols=30  Identities=20%  Similarity=0.311  Sum_probs=17.7

Q ss_pred             hhHHHH-----HHHHHHHHHHHHHHHHHhhhcccC
Q 042254           34 VPYLFG-----GLAAMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        34 vPYLFg-----GLA~MLgLIAvALLILACSy~K~s   63 (159)
                      +||+|.     ++.+.+++-.++|.+|-+-+-+.+
T Consensus       173 lPy~~~~~~~~a~~~si~l~~~aL~ilG~~~s~~s  207 (241)
T cd02435         173 LPYFFVSTVGEALLLSVIVTLVALFVFGYVKTWFT  207 (241)
T ss_pred             HHHHHccchhHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            478773     455555555666666666555544


No 57 
>PF14914 LRRC37AB_C:  LRRC37A/B like protein 1 C-terminal domain
Probab=32.63  E-value=52  Score=27.19  Aligned_cols=23  Identities=30%  Similarity=0.366  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHhhhcccCC
Q 042254           42 AAMLGLIAFALLILACSYWKLSD   64 (159)
Q Consensus        42 A~MLgLIAvALLILACSy~K~ss   64 (159)
                      +++|.||.+--||-.||+|+.+.
T Consensus       129 vv~~iliii~CLiei~shr~a~~  151 (154)
T PF14914_consen  129 VVVMILIIIFCLIEICSHRRASE  151 (154)
T ss_pred             HHHHHHHHHHHHHHHHhcccccc
Confidence            34566677777888899988654


No 58 
>PF04976 DmsC:  DMSO reductase anchor subunit (DmsC);  InterPro: IPR007059 The terminal electron transfer enzyme dimethyl sulphoxide reductase of Escherichia coli is a heterotrimeric enzyme composed of a membrane extrinsic catalytic dimer (DmsAB) and a membrane intrinsic polytopic anchor subunit (DmsC) []. This family represents DmsC.; GO: 0019645 anaerobic electron transport chain, 0016021 integral to membrane
Probab=32.28  E-value=62  Score=27.44  Aligned_cols=28  Identities=39%  Similarity=0.590  Sum_probs=20.3

Q ss_pred             cCCCCCCCCh-hHHHHHHHHHHHHHHHHH
Q 042254           25 QQRSPWHSPV-PYLFGGLAAMLGLIAFAL   52 (159)
Q Consensus        25 ~~~s~W~SPv-PYLFgGLA~MLgLIAvAL   52 (159)
                      ..+..||+|. |..|.|-++++|.+..++
T Consensus       140 ~~vp~W~~~~T~~~f~~tal~~G~~l~~~  168 (276)
T PF04976_consen  140 TTVPAWNSPWTPISFLGTALLLGAALAAL  168 (276)
T ss_pred             cchhcccCchHHHHHHHHHHHHHHHHHHH
Confidence            4567788884 556888888999865544


No 59 
>TIGR02976 phageshock_pspB phage shock protein B. This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response.
Probab=31.61  E-value=60  Score=23.49  Aligned_cols=28  Identities=21%  Similarity=0.214  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccC
Q 042254           36 YLFGGLAAMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        36 YLFgGLA~MLgLIAvALLILACSy~K~s   63 (159)
                      +.|..+-+++++|-||.+-|..-|++..
T Consensus         3 ~~fl~~Pliif~ifVap~wl~lHY~~k~   30 (75)
T TIGR02976         3 IFFLAIPLIIFVIFVAPLWLILHYRSKR   30 (75)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            4677777788888888888888888543


No 60 
>PF11143 DUF2919:  Protein of unknown function (DUF2919);  InterPro: IPR021318  This bacterial family of proteins has no known function. Some members are annotated as YfeZ however this cannot be confirmed. 
Probab=31.41  E-value=48  Score=26.47  Aligned_cols=23  Identities=30%  Similarity=0.232  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHHhhhcccC
Q 042254           40 GLAAMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        40 GLA~MLgLIAvALLILACSy~K~s   63 (159)
                      .|++.+|+.|+.++ +.|++|+..
T Consensus        57 ~lgL~~g~Pall~~-~l~~~R~~~   79 (149)
T PF11143_consen   57 YLGLAAGLPALLLM-LLSGRRHRS   79 (149)
T ss_pred             HHHHHHhHHHHHHH-HHHccCCCC
Confidence            46777899999888 888888743


No 61 
>PF04133 Vps55:  Vacuolar protein sorting 55 ;  InterPro: IPR007262 Vps55 is involved in the secretion of the Golgi form of the soluble vacuolar carboxypeptidase Y, but not the trafficking of the membrane-bound vacuolar alkaline phosphatase. Both Vps55 and obesity receptor gene-related protein are important for functioning membrane trafficking to the vacuole/lysosome of eukaryotic cells [].
Probab=31.07  E-value=50  Score=25.62  Aligned_cols=19  Identities=37%  Similarity=0.703  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHhhhccc
Q 042254           44 MLGLIAFALLILACSYWKL   62 (159)
Q Consensus        44 MLgLIAvALLILACSy~K~   62 (159)
                      .++-|++-|+||+|.-+|+
T Consensus         6 ~~~aiG~lL~IL~CAL~~n   24 (120)
T PF04133_consen    6 FFLAIGFLLVILSCALYKN   24 (120)
T ss_pred             HHHHHHHHHHHHHHHHhcc
Confidence            3456888999999997553


No 62 
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=30.65  E-value=45  Score=23.39  Aligned_cols=12  Identities=25%  Similarity=0.332  Sum_probs=6.6

Q ss_pred             HHHHHHHHHHhh
Q 042254           47 LIAFALLILACS   58 (159)
Q Consensus        47 LIAvALLILACS   58 (159)
                      ++|+|+++|+|.
T Consensus         5 I~Aiaf~vLvi~   16 (90)
T PF06103_consen    5 IAAIAFAVLVIF   16 (90)
T ss_pred             HHHHHHHHHHHH
Confidence            455555555554


No 63 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=30.53  E-value=64  Score=23.42  Aligned_cols=27  Identities=19%  Similarity=0.139  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhccc
Q 042254           36 YLFGGLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        36 YLFgGLA~MLgLIAvALLILACSy~K~   62 (159)
                      +.|...-+++++|-||.+-|..-|++.
T Consensus         3 ~~fl~~plivf~ifVap~WL~lHY~sk   29 (75)
T PF06667_consen    3 FEFLFVPLIVFMIFVAPIWLILHYRSK   29 (75)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            456666677777778887777777654


No 64 
>PF01794 Ferric_reduct:  Ferric reductase like transmembrane component;  InterPro: IPR013130 This family includes a common region in the transmembrane proteins mammalian cytochrome b-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from Arabidopsis thaliana. This may be a family of flavocytochromes capable of moving electrons across the plasma membrane [] that include a potential FAD binding domain. Mutations in the sequence of cytochrome b-245 heavy chain (gp91-phox) lead to the X-linked chronic granulomatous disease. The bacteriocidal ability of phagocytic cells is reduced and is characterised by the absence of a functional plasma membrane associated NADPH oxidase [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0016021 integral to membrane
Probab=30.40  E-value=95  Score=21.63  Aligned_cols=27  Identities=26%  Similarity=0.375  Sum_probs=18.3

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHhhh
Q 042254           33 PVPYLFGGLAAMLGLIAFALLILACSY   59 (159)
Q Consensus        33 PvPYLFgGLA~MLgLIAvALLILACSy   59 (159)
                      .-||...|+.+++.++.+++.-+.+-+
T Consensus        76 ~~~~~~~G~~a~~~l~~l~~tS~~~~R  102 (125)
T PF01794_consen   76 TGPYNLTGIIALLLLLILAVTSFPWIR  102 (125)
T ss_pred             HhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            346666777777777777766666666


No 65 
>PF13903 Claudin_2:  PMP-22/EMP/MP20/Claudin tight junction
Probab=29.88  E-value=81  Score=23.03  Aligned_cols=24  Identities=25%  Similarity=0.274  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhc
Q 042254           37 LFGGLAAMLGLIAFALLILACSYW   60 (159)
Q Consensus        37 LFgGLA~MLgLIAvALLILACSy~   60 (159)
                      .|..+++++.++++-+.++.|-++
T Consensus        73 ~~~~l~~~~~~~a~~~~~~~~~~~   96 (172)
T PF13903_consen   73 AFLILGLLLLLFAFVFALIGFCKR   96 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhcc
Confidence            344555555555555555544443


No 66 
>PTZ00370 STEVOR; Provisional
Probab=29.83  E-value=53  Score=29.60  Aligned_cols=24  Identities=33%  Similarity=0.405  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHH-Hhhhccc
Q 042254           39 GGLAAMLGLIAFALLIL-ACSYWKL   62 (159)
Q Consensus        39 gGLA~MLgLIAvALLIL-ACSy~K~   62 (159)
                      |--|+.|-+++|.|+|| .|=|||+
T Consensus       258 giaalvllil~vvliilYiwlyrrR  282 (296)
T PTZ00370        258 GIAALVLLILAVVLIILYIWLYRRR  282 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            33445566688888887 4556554


No 67 
>cd01324 cbb3_Oxidase_CcoQ Cytochrome cbb oxidase CcoQ.  Cytochrome cbb3 oxidase, the terminal oxidase in the respiratory chains of proteobacteria, is a multi-chain transmembrane protein located in the cell membrane. Like other cytochrome oxidases, it catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  Found exclusively in proteobacteria, cbb3 is believed to be a modern enzyme that has evolved independently to perform a specialized function in microaerobic energy metabolism. The cbb3 operon contains four genes (ccoNOQP or fixNOQP), with ccoN coding for subunit I.  Instead of a CuA-containing subunit II analogous to other cytochrome oxidases, cbb3 utilizes subunits ccoO and ccoP, which contain one and two hemes, respectively, to transfer electrons to the binuclear center.  ccoQ, the fourth subunit, is a single transmembrane helix protein.  It has been shown to protect the core complex from proteolytic degradation by serine proteases.  See cd00919, cd01322
Probab=29.79  E-value=1.2e+02  Score=19.96  Aligned_cols=28  Identities=25%  Similarity=0.324  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHH---HHHHHHHHHhhhcccCC
Q 042254           37 LFGGLAAMLGL---IAFALLILACSYWKLSD   64 (159)
Q Consensus        37 LFgGLA~MLgL---IAvALLILACSy~K~ss   64 (159)
                      .+-+++-..||   +++-+.|+.+.||+.+.
T Consensus         6 ~lr~~a~~~~l~~~~~~Figiv~wa~~p~~k   36 (48)
T cd01324           6 TLRGLADSWGLLYLALFFLGVVVWAFRPGRK   36 (48)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhCCCcc
Confidence            45666666666   55667778888887654


No 68 
>PF15240 Pro-rich:  Proline-rich
Probab=29.62  E-value=35  Score=28.58  Aligned_cols=13  Identities=46%  Similarity=0.672  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHH
Q 042254           44 MLGLIAFALLILA   56 (159)
Q Consensus        44 MLgLIAvALLILA   56 (159)
                      +|.|+.||||.|.
T Consensus         2 LlVLLSvALLALS   14 (179)
T PF15240_consen    2 LLVLLSVALLALS   14 (179)
T ss_pred             hhHHHHHHHHHhh
Confidence            4567888998885


No 69 
>PF04478 Mid2:  Mid2 like cell wall stress sensor;  InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway [].
Probab=29.48  E-value=19  Score=29.61  Aligned_cols=26  Identities=27%  Similarity=0.342  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHHhhhcccCCC
Q 042254           40 GLAAMLGLIAFALLILACSYWKLSDS   65 (159)
Q Consensus        40 GLA~MLgLIAvALLILACSy~K~ss~   65 (159)
                      |++.-|.|++++|+.+.|-++|....
T Consensus        57 GVGg~ill~il~lvf~~c~r~kktdf   82 (154)
T PF04478_consen   57 GVGGPILLGILALVFIFCIRRKKTDF   82 (154)
T ss_pred             cccHHHHHHHHHhheeEEEecccCcc
Confidence            34443334455555555656565443


No 70 
>PF03229 Alpha_GJ:  Alphavirus glycoprotein J;  InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [].; GO: 0019050 suppression by virus of host apoptosis
Probab=28.74  E-value=96  Score=24.93  Aligned_cols=37  Identities=38%  Similarity=0.442  Sum_probs=22.0

Q ss_pred             CCCCCCCC-----hhHHHHHHHHHHH--HHHHHHHHHHhhhccc
Q 042254           26 QRSPWHSP-----VPYLFGGLAAMLG--LIAFALLILACSYWKL   62 (159)
Q Consensus        26 ~~s~W~SP-----vPYLFgGLA~MLg--LIAvALLILACSy~K~   62 (159)
                      +..+|.||     +|-.+|||.+..-  +=|++||==.|-+|-+
T Consensus        73 ~~sp~ps~p~d~aLp~VIGGLcaL~LaamGA~~LLrR~cRr~ar  116 (126)
T PF03229_consen   73 SSSPGPSPPVDFALPLVIGGLCALTLAAMGAGALLRRCCRRAAR  116 (126)
T ss_pred             CCCCCCCCCcccchhhhhhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34677776     6888999876432  2334444446665543


No 71 
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=28.50  E-value=38  Score=20.26  Aligned_cols=20  Identities=30%  Similarity=0.575  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHHHhhhc
Q 042254           40 GLAAMLGLIAFALLILACSYW   60 (159)
Q Consensus        40 GLA~MLgLIAvALLILACSy~   60 (159)
                      |+++++.|. +-|+|.-|||.
T Consensus         5 ~FalivVLF-ILLiIvG~s~~   24 (24)
T PF09680_consen    5 GFALIVVLF-ILLIIVGASCF   24 (24)
T ss_pred             cchhHHHHH-HHHHHhcceeC
Confidence            455555553 34677778763


No 72 
>PF03381 CDC50:  LEM3 (ligand-effect modulator 3) family / CDC50 family;  InterPro: IPR005045 Members of this family have no known function. They have predicted transmembrane helices.; GO: 0016020 membrane
Probab=28.24  E-value=1e+02  Score=26.50  Aligned_cols=35  Identities=9%  Similarity=-0.042  Sum_probs=27.5

Q ss_pred             CCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 042254           28 SPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        28 s~W~SPvPYLFgGLA~MLgLIAvALLILACSy~K~   62 (159)
                      ...+--+.++|..++++..++++.|+++-+.+-|.
T Consensus       239 Ggkn~~Lgi~ylvvg~i~~v~~i~~~~~~~~~~r~  273 (278)
T PF03381_consen  239 GGKNYFLGIAYLVVGGICLVLAIIFLIIHYFKPRK  273 (278)
T ss_pred             CccccHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC
Confidence            44566678888888999999999999988776554


No 73 
>PHA00736 hypothetical protein
Probab=28.02  E-value=51  Score=24.35  Aligned_cols=14  Identities=50%  Similarity=0.795  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHH
Q 042254           37 LFGGLAAMLGLIAF   50 (159)
Q Consensus        37 LFgGLA~MLgLIAv   50 (159)
                      ||-|+++++||||=
T Consensus        57 lfwgi~vifgliag   70 (79)
T PHA00736         57 LFWGITVIFGLIAG   70 (79)
T ss_pred             HHHHHHHHHHHHHH
Confidence            68899999999974


No 74 
>PRK13823 conjugal transfer protein TrbD; Provisional
Probab=27.82  E-value=48  Score=24.87  Aligned_cols=18  Identities=50%  Similarity=0.685  Sum_probs=9.5

Q ss_pred             hHHHHH----HHHHHHHHHHHH
Q 042254           35 PYLFGG----LAAMLGLIAFAL   52 (159)
Q Consensus        35 PYLFgG----LA~MLgLIAvAL   52 (159)
                      |-|++|    |+++.|+||++|
T Consensus        15 p~Ll~Ga~R~l~i~~g~la~~l   36 (94)
T PRK13823         15 PNLFMGGDRELVMFSGLLAGIL   36 (94)
T ss_pred             cHhhCCcchHHHHHHHHHHHHH
Confidence            445554    555555555554


No 75 
>cd01059 CCC1_like CCC1-related family of proteins. CCC1_like: This protein family includes the proteins related to CCC1, a yeast vacuole transmembrane protein responsible for the iron and manganese transport from the cytosol into vacuole. It also includes the proteins similar to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation.
Probab=27.67  E-value=97  Score=23.77  Aligned_cols=30  Identities=37%  Similarity=0.507  Sum_probs=15.8

Q ss_pred             hhHHHHH---HHHHHHHH---HHHHHHHHhhhcccC
Q 042254           34 VPYLFGG---LAAMLGLI---AFALLILACSYWKLS   63 (159)
Q Consensus        34 vPYLFgG---LA~MLgLI---AvALLILACSy~K~s   63 (159)
                      +||+|..   +++.+.++   .++|.++.+...|.+
T Consensus        79 lp~~~~~~~~~a~~~si~~~~~~~l~~~g~~~~~~~  114 (143)
T cd01059          79 LPYLLLPAGSLALAVSVALVVALALFLLGAFVAKLG  114 (143)
T ss_pred             HHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            5787763   34444443   345555555555543


No 76 
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=27.49  E-value=27  Score=27.50  Aligned_cols=6  Identities=33%  Similarity=0.517  Sum_probs=3.3

Q ss_pred             CCChhH
Q 042254           31 HSPVPY   36 (159)
Q Consensus        31 ~SPvPY   36 (159)
                      .+|.-|
T Consensus        70 ~~p~~~   75 (179)
T PF13908_consen   70 YDPPIY   75 (179)
T ss_pred             cCcccc
Confidence            456555


No 77 
>PF06814 Lung_7-TM_R:  Lung seven transmembrane receptor;  InterPro: IPR009637 This family represents a conserved region with eukaryotic lung seven transmembrane receptors and related proteins.; GO: 0016021 integral to membrane
Probab=27.23  E-value=96  Score=26.06  Aligned_cols=36  Identities=17%  Similarity=0.312  Sum_probs=29.4

Q ss_pred             CCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhcccC
Q 042254           28 SPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        28 s~W~SPvPYLFgGLA~MLgLIAvALLILACSy~K~s   63 (159)
                      +-=.-|.|.+++.++++-++.++.-+.+.+.|||..
T Consensus        41 ~a~~~pl~~~y~~~~i~y~~~~~~W~~~~~~~~~~~   76 (295)
T PF06814_consen   41 PAGEYPLPPFYGVMSIVYAVLLIIWLFLCFKNRKSV   76 (295)
T ss_pred             ChhhcccHHHHHHHHHHHHHHHHHHHHHHHHHhcch
Confidence            334568999999999999999988888888888754


No 78 
>PF01594 UPF0118:  Domain of unknown function DUF20;  InterPro: IPR002549  This is a family of hypothetical proteins. A number of the sequence records state they are transmembrane proteins or putative permeases. It is not clear what source suggested that these proteins might be permeases and this information should be treated with caution.
Probab=27.01  E-value=89  Score=25.73  Aligned_cols=26  Identities=23%  Similarity=0.411  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcc
Q 042254           36 YLFGGLAAMLGLIAFALLILACSYWK   61 (159)
Q Consensus        36 YLFgGLA~MLgLIAvALLILACSy~K   61 (159)
                      ++||-+++++|.+.++++...|-.||
T Consensus       302 ~~fG~~G~il~~pi~~~~~~~~~~~~  327 (327)
T PF01594_consen  302 YLFGFIGLILAPPILAVIKAIFEEYR  327 (327)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHhC
Confidence            67888889999988888888887664


No 79 
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=26.75  E-value=75  Score=21.62  Aligned_cols=21  Identities=19%  Similarity=0.547  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHhhhcc
Q 042254           41 LAAMLGLIAFALLILACSYWK   61 (159)
Q Consensus        41 LA~MLgLIAvALLILACSy~K   61 (159)
                      +++|+.+++++|++-+|---+
T Consensus         6 i~~i~~~l~~~~~l~~CnTv~   26 (48)
T PRK10081          6 IAAIFSVLVLSTVLTACNTTR   26 (48)
T ss_pred             HHHHHHHHHHHHHHhhhhhhh
Confidence            567788888888888895444


No 80 
>TIGR03054 photo_alph_chp1 putative photosynthetic complex assembly protein. In twenty or so anoxygenic photosynthetic alpha-Proteobacteria known so far, a gene for a member of this protein family is present and is found in the vicinity of puhA, which encodes a component of the photosynthetic reaction center, and other genes associated with photosynthesis. This protein family is suggested, consequently, as a probable assembly factor for the photosynthetic reaction center, but its seems its actual function has not yet been demonstrated.
Probab=26.69  E-value=59  Score=25.97  Aligned_cols=23  Identities=30%  Similarity=0.387  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHHHHHHhhhccc
Q 042254           40 GLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        40 GLA~MLgLIAvALLILACSy~K~   62 (159)
                      -|-+|++|+.++|++.+.+++.-
T Consensus         3 ~l~a~~~Lvl~~~~lva~a~~Tg   25 (135)
T TIGR03054         3 LLIAMLGLVLLTFALVAFAVLTG   25 (135)
T ss_pred             HHHHHHHHHHHHHHHhheeeecC
Confidence            46789999999999999998873


No 81 
>PRK10884 SH3 domain-containing protein; Provisional
Probab=26.67  E-value=55  Score=27.34  Aligned_cols=18  Identities=39%  Similarity=0.931  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 042254           36 YLFGGLAAMLGLIAFALLI   54 (159)
Q Consensus        36 YLFgGLA~MLgLIAvALLI   54 (159)
                      |+.||+.+.+||| +.||+
T Consensus       174 f~~Gg~v~~~Gll-lGlil  191 (206)
T PRK10884        174 FMYGGGVAGIGLL-LGLLL  191 (206)
T ss_pred             HHHchHHHHHHHH-HHHHh
Confidence            6789999999998 44443


No 82 
>KOG1053 consensus Glutamate-gated NMDA-type ion channel receptor subunit GRIN2A and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms]
Probab=26.30  E-value=59  Score=34.04  Aligned_cols=26  Identities=35%  Similarity=0.810  Sum_probs=21.9

Q ss_pred             HHHHHHHHHH-HHHHHHHHHhh---hcccC
Q 042254           38 FGGLAAMLGL-IAFALLILACS---YWKLS   63 (159)
Q Consensus        38 FgGLA~MLgL-IAvALLILACS---y~K~s   63 (159)
                      |.|+..||+. ++++||+++|-   |||+.
T Consensus       826 maGvFymL~~amgLSllvfi~EHlvYw~Lr  855 (1258)
T KOG1053|consen  826 MAGVFYMLAVAMGLSLLVFIWEHLVYWKLR  855 (1258)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            6788888877 89999999996   88865


No 83 
>PRK12361 hypothetical protein; Provisional
Probab=26.27  E-value=84  Score=28.87  Aligned_cols=14  Identities=29%  Similarity=0.933  Sum_probs=10.4

Q ss_pred             HHHHHHHHHhhhcc
Q 042254           48 IAFALLILACSYWK   61 (159)
Q Consensus        48 IAvALLILACSy~K   61 (159)
                      .|+||++.++.|+-
T Consensus        37 ~~~~~~~v~~~y~~   50 (547)
T PRK12361         37 ISLSLFLVGSAYWF   50 (547)
T ss_pred             HHHHHHHHHHHHHh
Confidence            67777888888764


No 84 
>PF10826 DUF2551:  Protein of unknown function (DUF2551) ;  InterPro: IPR020501 This entry contains proteins with no known function.
Probab=26.14  E-value=50  Score=24.75  Aligned_cols=20  Identities=45%  Similarity=0.669  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHh
Q 042254           38 FGGLAAMLGLIAFALLILAC   57 (159)
Q Consensus        38 FgGLA~MLgLIAvALLILAC   57 (159)
                      +=|.|+|+|+|+-=|-||--
T Consensus        43 ~~~VasMVG~i~SrlGIL~~   62 (83)
T PF10826_consen   43 YRGVASMVGLIHSRLGILSI   62 (83)
T ss_pred             HHHHHHHHHHHHHhhhheee
Confidence            35899999999999998863


No 85 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=25.70  E-value=23  Score=31.36  Aligned_cols=11  Identities=55%  Similarity=0.767  Sum_probs=0.0

Q ss_pred             cEEEEecCCCCC
Q 042254           89 KILVIMAGDEKP  100 (159)
Q Consensus        89 KIvVIMAGDe~P  100 (159)
                      |-=||| =||||
T Consensus       209 ~~P~Il-keEkP  219 (290)
T PF05454_consen  209 KSPVIL-KEEKP  219 (290)
T ss_dssp             ------------
T ss_pred             CCCeee-cccCC
Confidence            444666 34554


No 86 
>PF06800 Sugar_transport:  Sugar transport protein;  InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long. Members include glucose uptake proteins [], ribose transport proteins, and several putative and hypothetical membrane proteins probably involved in sugar transport across bacterial membranes.; GO: 0015144 carbohydrate transmembrane transporter activity, 0034219 carbohydrate transmembrane transport, 0016021 integral to membrane
Probab=25.39  E-value=89  Score=27.39  Aligned_cols=33  Identities=27%  Similarity=0.351  Sum_probs=25.6

Q ss_pred             CCCCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 042254           26 QRSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        26 ~~s~W~SPvPYLFgGLA~MLgLIAvALLILACSy~K~   62 (159)
                      -+..|++..-++||-+|+++-+|.+.|    |||++.
T Consensus        93 ~fgEW~~~~~~~~G~~Al~liiiGv~l----ts~~~~  125 (269)
T PF06800_consen   93 FFGEWTTTTQKIIGFLALVLIIIGVIL----TSYQDK  125 (269)
T ss_pred             hcCCCCCcchHHHHHHHHHHHHHHHHH----hccccc
Confidence            478999999999999888777777654    566543


No 87 
>PRK13792 lysozyme inhibitor; Provisional
Probab=25.32  E-value=37  Score=26.82  Aligned_cols=21  Identities=29%  Similarity=0.279  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHhhhccc
Q 042254           42 AAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        42 A~MLgLIAvALLILACSy~K~   62 (159)
                      ++++.|+++++|+-+||.-..
T Consensus         4 ~l~~ll~~~~~lLsaCs~~~~   24 (127)
T PRK13792          4 ALWLLLAAVPVVLVACGGSDD   24 (127)
T ss_pred             HHHHHHHHHHhheecccCCCC
Confidence            467788899999999998654


No 88 
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms]
Probab=25.25  E-value=71  Score=32.11  Aligned_cols=25  Identities=28%  Similarity=0.433  Sum_probs=21.9

Q ss_pred             CCChhHHHHHHHHHHHHHHHHHHHH
Q 042254           31 HSPVPYLFGGLAAMLGLIAFALLIL   55 (159)
Q Consensus        31 ~SPvPYLFgGLA~MLgLIAvALLIL   55 (159)
                      ++-.=|+|--|+.|||+.+|||||=
T Consensus       425 ~~~~E~Vf~~~~w~mGVFvFslliG  449 (815)
T KOG0499|consen  425 QTLFEIVFQLLNWFMGVFVFSLLIG  449 (815)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4456799999999999999999984


No 89 
>PRK09458 pspB phage shock protein B; Provisional
Probab=25.11  E-value=90  Score=22.96  Aligned_cols=27  Identities=19%  Similarity=0.128  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhccc
Q 042254           36 YLFGGLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        36 YLFgGLA~MLgLIAvALLILACSy~K~   62 (159)
                      ++|.+.-+++++|-||.+=|..-|+..
T Consensus         3 ~~fl~~PliiF~ifVaPiWL~LHY~sk   29 (75)
T PRK09458          3 ALFLAIPLTIFVLFVAPIWLWLHYRSK   29 (75)
T ss_pred             chHHHHhHHHHHHHHHHHHHHHhhccc
Confidence            678888899999999999999988753


No 90 
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=24.92  E-value=63  Score=25.29  Aligned_cols=23  Identities=22%  Similarity=0.232  Sum_probs=17.4

Q ss_pred             cCCCCCCCChhHHHHHHHHHHHH
Q 042254           25 QQRSPWHSPVPYLFGGLAAMLGL   47 (159)
Q Consensus        25 ~~~s~W~SPvPYLFgGLA~MLgL   47 (159)
                      .|+..++.|..+.||||+.+||=
T Consensus        20 ~P~f~~~~p~~~~yg~lG~ilah   42 (206)
T PF01431_consen   20 PPFFDPNYPPALNYGGLGFILAH   42 (206)
T ss_dssp             TTT--TTS-HHHHHHTHHHHHHH
T ss_pred             CccCCCCCCHHHHHHHHHHHHHH
Confidence            56678899999999999998875


No 91 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=24.77  E-value=2.6e+02  Score=21.92  Aligned_cols=22  Identities=18%  Similarity=0.208  Sum_probs=15.4

Q ss_pred             ccCccEEEEe-cCCCCCccccccC
Q 042254           85 VYEEKILVIM-AGDEKPTFLATPV  107 (159)
Q Consensus        85 ~~EpKIvVIM-AGDe~PTfLA~P~  107 (159)
                      ..+ .|+|=+ .++....||---+
T Consensus        63 ~L~-~f~VNL~~~~~~~rylkv~i   85 (162)
T PRK07021         63 PLE-TFTVNLQPDDDADRVLYVGL   85 (162)
T ss_pred             ecC-CEEEEcCCCCCCceEEEEEE
Confidence            345 488888 5666788987554


No 92 
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=24.06  E-value=2.9e+02  Score=21.83  Aligned_cols=22  Identities=9%  Similarity=0.255  Sum_probs=16.8

Q ss_pred             cCccEEEEecCCCCCccccccC
Q 042254           86 YEEKILVIMAGDEKPTFLATPV  107 (159)
Q Consensus        86 ~EpKIvVIMAGDe~PTfLA~P~  107 (159)
                      .+|-|+|=++|+..-.||-.-+
T Consensus        72 l~~~fvvNl~~~~~~ryLkv~i   93 (170)
T PRK05696         72 MPRPFVFNVPGNGRDRLVQIKV   93 (170)
T ss_pred             cCCCEEEEecCCCCceEEEEEE
Confidence            3567999998888888987544


No 93 
>PF11353 DUF3153:  Protein of unknown function (DUF3153);  InterPro: IPR021499  This family of proteins with unknown function appear to be restricted to Cyanobacteria. Some members are annotated as membrane proteins however this cannot be confirmed. 
Probab=24.04  E-value=79  Score=25.71  Aligned_cols=7  Identities=0%  Similarity=-0.572  Sum_probs=5.1

Q ss_pred             cCCCCCC
Q 042254           25 QQRSPWH   31 (159)
Q Consensus        25 ~~~s~W~   31 (159)
                      ..+|.|+
T Consensus       177 ~~~w~pn  183 (209)
T PF11353_consen  177 ASFWVPN  183 (209)
T ss_pred             EEEEecc
Confidence            5668888


No 94 
>PF06716 DUF1201:  Protein of unknown function (DUF1201);  InterPro: IPR009591 This entry consists of several Beet yellows virus (BYV) putative membrane-binding proteins of around 54 residues in length. The function of this currently unknown.
Probab=23.76  E-value=1.2e+02  Score=21.00  Aligned_cols=28  Identities=21%  Similarity=0.433  Sum_probs=19.4

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhhccc
Q 042254           35 PYLFGGLAAMLGLIAFALLILACSYWKL   62 (159)
Q Consensus        35 PYLFgGLA~MLgLIAvALLILACSy~K~   62 (159)
                      .||..|+++.+.|.-+-|.+..+-..|.
T Consensus         7 s~L~~~F~~lIC~Fl~~~~~F~~F~~Kq   34 (54)
T PF06716_consen    7 SYLLLAFGFLICLFLFCLVVFIWFVYKQ   34 (54)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5899999998888555555555555553


No 95 
>PF07937 DUF1686:  Protein of unknown function (DUF1686);  InterPro: IPR012468 The members of this family are all hypothetical proteins of unknown function expressed by the eukaryotic parasite Encephalitozoon cuniculi GB-M1. The region in question is approximately 250 amino acids long. 
Probab=23.72  E-value=63  Score=27.39  Aligned_cols=18  Identities=44%  Similarity=0.864  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHhhhcc
Q 042254           44 MLGLIAFALLILACSYWK   61 (159)
Q Consensus        44 MLgLIAvALLILACSy~K   61 (159)
                      -+|||.||+|+|.++|-+
T Consensus       129 ~~g~Vvfa~lLllv~y~e  146 (185)
T PF07937_consen  129 CVGLVVFAILLLLVSYME  146 (185)
T ss_pred             ehHHHHHHHHHHHHHHHH
Confidence            368999999999999974


No 96 
>TIGR03750 conj_TIGR03750 conjugative transfer region protein, TIGR03750 family. Members of this protein family are found occasionally on plasmids. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition.
Probab=23.71  E-value=1.1e+02  Score=23.62  Aligned_cols=29  Identities=21%  Similarity=0.162  Sum_probs=20.2

Q ss_pred             CChhHHHHHHHHH--HHHHHHHHHHHHhhhc
Q 042254           32 SPVPYLFGGLAAM--LGLIAFALLILACSYW   60 (159)
Q Consensus        32 SPvPYLFgGLA~M--LgLIAvALLILACSy~   60 (159)
                      -|.-++|++++++  ..||.++|.|+.|+.+
T Consensus        39 ~~l~~~~~~w~~~p~~~lig~~l~v~~gg~~   69 (111)
T TIGR03750        39 LLLALLAGPWALIPTGALLGPILVVLIGGKL   69 (111)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhHHH
Confidence            3444666656554  5678889999999854


No 97 
>cd02434 Nodulin-21_like_3 Nodulin-21 and CCC1-related protein family. Nodulin-21_like_3: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter.
Probab=23.64  E-value=94  Score=25.91  Aligned_cols=23  Identities=30%  Similarity=0.386  Sum_probs=12.6

Q ss_pred             HHHHHHH-HHHHHHHHHhhhcccC
Q 042254           41 LAAMLGL-IAFALLILACSYWKLS   63 (159)
Q Consensus        41 LA~MLgL-IAvALLILACSy~K~s   63 (159)
                      +...+++ -.++|+++-+..-+.+
T Consensus       172 ~~~s~~~~~~~~L~~~G~~~~~~~  195 (225)
T cd02434         172 FALSILIFVAFTLFLLGSFKSKLY  195 (225)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhc
Confidence            3444554 5566666666555543


No 98 
>COG1704 LemA Uncharacterized conserved protein [Function unknown]
Probab=23.45  E-value=67  Score=27.12  Aligned_cols=24  Identities=25%  Similarity=0.382  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHHHHhhhcccCC
Q 042254           41 LAAMLGLIAFALLILACSYWKLSD   64 (159)
Q Consensus        41 LA~MLgLIAvALLILACSy~K~ss   64 (159)
                      +-..+++|.+.+++..|+|..+-.
T Consensus         4 ~~i~l~vi~il~ll~~~~yN~lv~   27 (185)
T COG1704           4 FLIILAVIVILLLLAVGGYNGLVK   27 (185)
T ss_pred             hHHHHHHHHHHHHHHHHhhhhHHH
Confidence            445667777777777999987643


No 99 
>PRK11486 flagellar biosynthesis protein FliO; Provisional
Probab=23.45  E-value=1.3e+02  Score=23.75  Aligned_cols=56  Identities=16%  Similarity=0.076  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHhhhcccCCCCCcccCCCCCCCcccCCccccCccEEEEecCCC
Q 042254           43 AMLGLIAFALLILACSYWKLSDSRDIESGDKGQEGDAANSVKVYEEKILVIMAGDE   98 (159)
Q Consensus        43 ~MLgLIAvALLILACSy~K~ss~~d~e~~~~~~~~~~~~~~~~~EpKIvVIMAGDe   98 (159)
                      ++.+|+.|-++|++|.|-=..-...........=+--...+.--.||||||=.||+
T Consensus        21 v~~~L~lVl~lI~~~aWLlkR~~~~~~~~~~~~lkVva~~slG~RErvvvVeV~~~   76 (124)
T PRK11486         21 VSGALIGIIALILAAAWLVKRLGFAPKRTGVRGLKISASASLGARERVVIVDVEDA   76 (124)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcCCCCCCCCCcceEEEEeeccCCccEEEEEEECCE


No 100
>PF11677 DUF3273:  Protein of unknown function (DUF3273);  InterPro: IPR021691  Some members in this family of proteins are annotated as multi-transmembrane proteins however this cannot be confirmed. Currently this family has no known function. 
Probab=23.44  E-value=1.7e+02  Score=26.04  Aligned_cols=39  Identities=31%  Similarity=0.537  Sum_probs=29.4

Q ss_pred             cCCCCCCCChhHHHHH--HHHHHHHHHHHHHHHHhhhcccC
Q 042254           25 QQRSPWHSPVPYLFGG--LAAMLGLIAFALLILACSYWKLS   63 (159)
Q Consensus        25 ~~~s~W~SPvPYLFgG--LA~MLgLIAvALLILACSy~K~s   63 (159)
                      .++.+=++|+.+.|.-  |=.=++|..++|++|.|+||-..
T Consensus         6 ~~RGp~~~pf~~ff~~~~LR~Gf~lq~~~~~ll~i~y~a~G   46 (265)
T PF11677_consen    6 EGRGPSHTPFWGFFSSYNLRLGFLLQLLSLILLFISYWAFG   46 (265)
T ss_pred             CCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcC
Confidence            4566778999999976  33345567888889999999743


No 101
>PF15345 TMEM51:  Transmembrane protein 51
Probab=23.38  E-value=44  Score=29.18  Aligned_cols=30  Identities=23%  Similarity=0.234  Sum_probs=23.8

Q ss_pred             CCCCCCChhHHHHHHHHHHHHHHHHHHHHH
Q 042254           27 RSPWHSPVPYLFGGLAAMLGLIAFALLILA   56 (159)
Q Consensus        27 ~s~W~SPvPYLFgGLA~MLgLIAvALLILA   56 (159)
                      ...=.+-|-|.+.|-++||.|+++.|-|--
T Consensus        53 ~ksKt~SVAyVLVG~Gv~LLLLSICL~IR~   82 (233)
T PF15345_consen   53 LKSKTFSVAYVLVGSGVALLLLSICLSIRD   82 (233)
T ss_pred             ccceeEEEEEehhhHHHHHHHHHHHHHHHH
Confidence            344456789999999999999998887754


No 102
>cd02437 CCC1_like_1 CCC1-related protein family. CCC1_like_1: This is a protein family closely related to CCC1, a family of proteins involved in iron and manganese transport. Yeast CCC1 is a vacuole transmembrane protein responsible for the iron and manganese accumulation in vacuole.
Probab=23.32  E-value=1.2e+02  Score=23.97  Aligned_cols=16  Identities=31%  Similarity=0.299  Sum_probs=7.9

Q ss_pred             HHHHHHHHHhhhcccC
Q 042254           48 IAFALLILACSYWKLS   63 (159)
Q Consensus        48 IAvALLILACSy~K~s   63 (159)
                      ..++|.++-+.+.|.+
T Consensus       131 ~~~~L~~~G~~~~~~~  146 (175)
T cd02437         131 VLAILFILGLVIGKIS  146 (175)
T ss_pred             HHHHHHHHHHHHHHHc
Confidence            3344555555555543


No 103
>TIGR03363 VI_chp_8 type VI secretion-associated protein, ImpA family. This protein family is one of two related families in type VI secretion systems that contain an ImpA-related N-terminal domain (pfam06812).
Probab=23.22  E-value=40  Score=29.73  Aligned_cols=9  Identities=78%  Similarity=1.435  Sum_probs=7.7

Q ss_pred             CCChhHHHH
Q 042254           31 HSPVPYLFG   39 (159)
Q Consensus        31 ~SPvPYLFg   39 (159)
                      |||||||.=
T Consensus       313 hSPvp~Ll~  321 (353)
T TIGR03363       313 HSPVPYLIE  321 (353)
T ss_pred             CCcHHHHHH
Confidence            799999964


No 104
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=23.15  E-value=1.2e+02  Score=17.47  Aligned_cols=7  Identities=43%  Similarity=0.472  Sum_probs=3.2

Q ss_pred             hHHHHHH
Q 042254           35 PYLFGGL   41 (159)
Q Consensus        35 PYLFgGL   41 (159)
                      -+++.|+
T Consensus        12 ~~~~~G~   18 (34)
T TIGR01167        12 LLLLLGL   18 (34)
T ss_pred             HHHHHHH
Confidence            3444454


No 105
>PF02411 MerT:  MerT mercuric transport protein;  InterPro: IPR003457 MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerA).; GO: 0015097 mercury ion transmembrane transporter activity, 0015694 mercury ion transport, 0016020 membrane
Probab=22.88  E-value=1e+02  Score=23.78  Aligned_cols=17  Identities=41%  Similarity=0.964  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHhhhcccC
Q 042254           47 LIAFALLILACSYWKLS   63 (159)
Q Consensus        47 LIAvALLILACSy~K~s   63 (159)
                      +|+++|++|...+|+.-
T Consensus        54 fi~~tl~~lg~a~~~~y   70 (116)
T PF02411_consen   54 FIALTLLFLGYAFWRLY   70 (116)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            68889999999988754


No 106
>PF07589 VPEP:  PEP-CTERM motif;  InterPro: IPR013424  This entry describes a 25-residue region including an invariant Pro-Glu-Pro (PEP) motif, a thirteen residue strongly hydrophobic sequence likely to span the membrane, and a five-residue strongly basic motif that often contains four Arg residues. In most cases, this motif is found within nine residues of the C-terminal end of the protein. Proteins containing this motif typically have signal sequences at the N terminus [].
Probab=22.76  E-value=1e+02  Score=17.84  Aligned_cols=11  Identities=45%  Similarity=0.573  Sum_probs=4.6

Q ss_pred             HHHHHHHHHHh
Q 042254           47 LIAFALLILAC   57 (159)
Q Consensus        47 LIAvALLILAC   57 (159)
                      |+.+.|+.|+.
T Consensus        10 l~~~gl~~l~~   20 (25)
T PF07589_consen   10 LLGLGLLGLAF   20 (25)
T ss_pred             HHHHHHHHHHH
Confidence            33334444444


No 107
>PF00822 PMP22_Claudin:  PMP-22/EMP/MP20/Claudin family;  InterPro: IPR004031 Several vertebrate small integral membrane glycoproteins are evolutionary related [, , ], including eye lens specific membrane protein 20 (MP20 or MP19); epithelial membrane protein-1 (EMP-1), which is also known as tumor-associated membrane protein (TMP) or as squamous cell-specific protein Cl-20; epithelial membrane protein-2 (EMP-2), which is also known as XMP; epithelial membrane protein-3 (EMP-3), also known as YMP; and peripheral myelin protein 22 (PMP-22), which is expressed in many tissues but mainly by Schwann cells as a component of myelin of the peripheral nervous system (PNS). PMP-22 probably plays a role both in myelinization and in cell proliferation. Mutations affecting PMP-22 are associated with hereditary motor and sensory neuropathies such as Charcot-Marie-Tooth disease type 1A (CMT-1A) in human or the trembler phenotype in mice. The proteins of this family are about 160 to 173 amino acid residues in size, and contain four transmembrane segments. PMP-22, EMP-1, -2 and -3 are highly similar, while MP20 is more distantly related. This family also includes the claudins, which are components of tight junctions.; GO: 0016020 membrane
Probab=22.67  E-value=1.1e+02  Score=22.55  Aligned_cols=29  Identities=34%  Similarity=0.441  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHH-hh-hcccCCC
Q 042254           37 LFGGLAAMLGLIAFALLILA-CS-YWKLSDS   65 (159)
Q Consensus        37 LFgGLA~MLgLIAvALLILA-CS-y~K~ss~   65 (159)
                      |.....+++.+.+++|++.+ .+ ||+.+..
T Consensus         3 ~q~~~~~~~~~~~~~~liva~~~~~W~~~~~   33 (166)
T PF00822_consen    3 LQLAGFIVSSLGWLALLIVATATPYWRVSNV   33 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCchHheEecC
Confidence            44455556666677665555 45 8987654


No 108
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=22.45  E-value=70  Score=25.91  Aligned_cols=18  Identities=28%  Similarity=0.313  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHhhhcccC
Q 042254           46 GLIAFALLILACSYWKLS   63 (159)
Q Consensus        46 gLIAvALLILACSy~K~s   63 (159)
                      .||.+.|++.+|+-.+..
T Consensus         5 ~~l~l~lll~~C~~~~~~   22 (216)
T PF11153_consen    5 LLLLLLLLLTGCSTNPNE   22 (216)
T ss_pred             HHHHHHHHHHhhcCCCcc
Confidence            345589999999987654


No 109
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=22.32  E-value=1e+02  Score=20.21  Aligned_cols=33  Identities=27%  Similarity=0.138  Sum_probs=19.1

Q ss_pred             ccccCCCCCCCChhH-HHHHHHHHHHHHHHHHHH
Q 042254           22 VATQQRSPWHSPVPY-LFGGLAAMLGLIAFALLI   54 (159)
Q Consensus        22 ~~~~~~s~W~SPvPY-LFgGLA~MLgLIAvALLI   54 (159)
                      ++.-.+..|+.+.|. ++..+++.+|+|...|+.
T Consensus         6 ~V~v~~~~~~~~~pl~l~il~~f~~G~llg~l~~   39 (68)
T PF06305_consen    6 PVTVNFLFGQFPLPLGLLILIAFLLGALLGWLLS   39 (68)
T ss_pred             eEEEEEEeeeccchHHHHHHHHHHHHHHHHHHHH
Confidence            445566778887774 444455556655554433


No 110
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=22.31  E-value=1.5e+02  Score=22.83  Aligned_cols=27  Identities=22%  Similarity=0.370  Sum_probs=22.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhhc
Q 042254           34 VPYLFGGLAAMLGLIAFALLILACSYW   60 (159)
Q Consensus        34 vPYLFgGLA~MLgLIAvALLILACSy~   60 (159)
                      +|+--..||+.|.++...||++.|--+
T Consensus        39 ~pwK~I~la~~Lli~G~~li~~g~l~~   65 (115)
T PF05915_consen   39 IPWKSIALAVFLLIFGTVLIIIGLLLF   65 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            568889999999999999988887644


No 111
>PRK13415 flagella biosynthesis protein FliZ; Provisional
Probab=22.27  E-value=1.6e+02  Score=25.39  Aligned_cols=23  Identities=22%  Similarity=0.236  Sum_probs=10.6

Q ss_pred             ccCCCCCCCChhHHHHHHHHHHHHH
Q 042254           24 TQQRSPWHSPVPYLFGGLAAMLGLI   48 (159)
Q Consensus        24 ~~~~s~W~SPvPYLFgGLA~MLgLI   48 (159)
                      ..+.+.|.  +-=++++|+++++||
T Consensus        60 ~~~~s~~~--l~qmi~aL~~VI~Li   82 (219)
T PRK13415         60 ASSVSAFD--FVKLIGATLFVIFLI   82 (219)
T ss_pred             CCCccHHH--HHHHHHHHHHHHHHH
Confidence            34455554  334455554444443


No 112
>PHA02337 putative high light inducible protein
Probab=22.25  E-value=1.9e+02  Score=18.55  Aligned_cols=23  Identities=39%  Similarity=0.626  Sum_probs=15.9

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHH
Q 042254           33 PVPYLFGGLAAMLGLIAFALLILA   56 (159)
Q Consensus        33 PvPYLFgGLA~MLgLIAvALLILA   56 (159)
                      |-+=.+-|-.+|+|+++ +|++-.
T Consensus         3 ~~aE~~NGRlAMiGfv~-~~~~e~   25 (35)
T PHA02337          3 PEAEIFNGWLAMIGFVA-AVGAYA   25 (35)
T ss_pred             cHHHHHhhHHHHHHHHH-HHHHHH
Confidence            44556779999999988 444433


No 113
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=22.16  E-value=2.3e+02  Score=19.19  Aligned_cols=22  Identities=14%  Similarity=0.076  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHhhhcccCCCCC
Q 042254           46 GLIAFALLILACSYWKLSDSRD   67 (159)
Q Consensus        46 gLIAvALLILACSy~K~ss~~d   67 (159)
                      ..|.+-|.++.|.--|.-+|++
T Consensus        10 ~iv~~lLg~~I~~~~K~ygYkh   31 (50)
T PF12606_consen   10 FIVMGLLGLSICTTLKAYGYKH   31 (50)
T ss_pred             HHHHHHHHHHHHHHhhcccccc
Confidence            3344456778888888777754


No 114
>TIGR02830 spore_III_AG stage III sporulation protein AG. CC A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AG.
Probab=22.01  E-value=77  Score=26.41  Aligned_cols=18  Identities=33%  Similarity=0.471  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHHHHHhhh
Q 042254           42 AAMLGLIAFALLILACSY   59 (159)
Q Consensus        42 A~MLgLIAvALLILACSy   59 (159)
                      .++|+||.++|||+.=.+
T Consensus         6 l~il~l~GvlLli~s~~f   23 (186)
T TIGR02830         6 LLVLLLIGLLLLIVSSFF   23 (186)
T ss_pred             HHHHHHHHHHHHHhhccc
Confidence            456778888888876443


No 115
>PF01490 Aa_trans:  Transmembrane amino acid transporter protein;  InterPro: IPR013057 This transmembrane region is found in many amino acid transporters including P34579 from SWISSPROT (UNC-47) and P40501 from SWISSPROT (MTR). UNC-47 encodes a vesicular amino butyric acid (GABA) transporter, (VGAT) and is is predicted to have 10 transmembrane domains UNC47_CAEEL []. MTR is an N system amino acid transporter system protein involved in methyltryptophan resistance MTR_NEUCR. Other members of this family include proline transporters and amino acid transporters whose specificity has not yet been identified.
Probab=21.96  E-value=1.1e+02  Score=25.70  Aligned_cols=25  Identities=32%  Similarity=0.576  Sum_probs=17.4

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhh
Q 042254           34 VPYLFGGLAAMLGLIAFALLILACS   58 (159)
Q Consensus        34 vPYLFgGLA~MLgLIAvALLILACS   58 (159)
                      .||-|.-.+.++|+|.+.++.+.|.
T Consensus        24 lP~af~~~G~~~g~i~l~~~~~~s~   48 (409)
T PF01490_consen   24 LPYAFAQSGWVLGIILLVLVALLSY   48 (409)
T ss_pred             HHHHHHHhhhhhhhHHHHHHHHHHH
Confidence            7999987777777766655555443


No 116
>COG4594 FecB ABC-type Fe3+-citrate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=21.73  E-value=1.5e+02  Score=26.92  Aligned_cols=20  Identities=40%  Similarity=0.549  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHhhhc
Q 042254           41 LAAMLGLIAFALLILACSYW   60 (159)
Q Consensus        41 LA~MLgLIAvALLILACSy~   60 (159)
                      +++|++|+..-||+-+||-.
T Consensus         6 ~~~i~~lll~lllva~C~~s   25 (310)
T COG4594           6 TAIILTLLLLLLLVAACSSS   25 (310)
T ss_pred             hHHHHHHHHHHHHHHHhcCc
Confidence            57889999999999999864


No 117
>PF06779 DUF1228:  Protein of unknown function (DUF1228);  InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters. Note that many members are hypothetical proteins.
Probab=21.42  E-value=1.6e+02  Score=21.46  Aligned_cols=15  Identities=27%  Similarity=0.259  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHHHhhh
Q 042254           45 LGLIAFALLILACSY   59 (159)
Q Consensus        45 LgLIAvALLILACSy   59 (159)
                      ++|++.+++.++|..
T Consensus        62 ~~l~~~~~~~~~ma~   76 (85)
T PF06779_consen   62 AGLLLTVLSTAAMAL   76 (85)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            345555555555543


No 118
>PF03904 DUF334:  Domain of unknown function (DUF334);  InterPro: IPR005602 This is a family of proteins found in Staphylococcus aureus plasmid with no characterised function.
Probab=21.04  E-value=1.1e+02  Score=26.65  Aligned_cols=23  Identities=30%  Similarity=0.535  Sum_probs=17.2

Q ss_pred             hhHHHHHHHHHHHH-HHHHHHHHH
Q 042254           34 VPYLFGGLAAMLGL-IAFALLILA   56 (159)
Q Consensus        34 vPYLFgGLA~MLgL-IAvALLILA   56 (159)
                      .-.+|-|+.+||++ +.|+|+.+.
T Consensus       147 ~k~~~~gi~aml~Vf~LF~lvmt~  170 (230)
T PF03904_consen  147 QKSMYKGIGAMLFVFMLFALVMTI  170 (230)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHh
Confidence            34688899999887 566777665


No 119
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=20.90  E-value=1.6e+02  Score=23.11  Aligned_cols=30  Identities=23%  Similarity=0.330  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhcccCCC
Q 042254           36 YLFGGLAAMLGLIAFALLILACSYWKLSDS   65 (159)
Q Consensus        36 YLFgGLA~MLgLIAvALLILACSy~K~ss~   65 (159)
                      .+||-+|.++|+|++.+.++-=-++|.+..
T Consensus        69 Ii~gv~aGvIg~Illi~y~irR~~Kk~~~~   98 (122)
T PF01102_consen   69 IIFGVMAGVIGIILLISYCIRRLRKKSSSD   98 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHS------
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhccCCCC
Confidence            356666666667666666666666766543


No 120
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=20.82  E-value=1.2e+02  Score=30.86  Aligned_cols=25  Identities=20%  Similarity=0.356  Sum_probs=15.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhh
Q 042254           34 VPYLFGGLAAMLGLIAFALLILACS   58 (159)
Q Consensus        34 vPYLFgGLA~MLgLIAvALLILACS   58 (159)
                      +=||.+-|+.|+.|+-+-|.+|.|-
T Consensus       272 T~fLl~ILG~~~livl~lL~vLl~y  296 (807)
T PF10577_consen  272 TVFLLAILGGTALIVLILLCVLLCY  296 (807)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4566677776666655555555554


No 121
>PF03345 DDOST_48kD:  Oligosaccharyltransferase 48 kDa subunit beta;  InterPro: IPR005013 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins [, ]. The oligosaccharyl transferase complex (OST complex) 2.4.1.119 from EC transfers 14-sugar branched oligosaccharides from dolichyl pyrophosphate to asparagine residues []. The complex contains nine protein subunits: Ost1p, Ost2p, Ost3p, Ost4p, Ost5p, Ost6p, Stt3p, Swp1p, and Wbp1p, all of which are integral membrane proteins of the ER. The OST complex interacts with the Sec61p pore complex [] involved in protein import into the ER. This entry represents subunits OST3 and OST6. OST3 is homologous to OST6 [], and several lines of evidence indicate that they are alternative members of the OST complex. Disruption of both OST3 and OST6 causes severe underglycosylation of soluble and membrane-bound glycoproteins and a defect in the assembly of the complex. Hence, the function of these genes seems to be essential for recruiting a fully active complex necessary for efficient N-glycosylation []. This entry also includes the magnesium transporter protein 1, also known as OST3 homologue B, which might be involved in N-glycosylation through its association with the oligosaccharyl transferase (OST) complex. Wbp1p is the beta subunit of the OST complex, one of the original six subunits purified []. Wbp1 is essential [, ], but conditional mutants have decreased transferase activity [, ]. Wbp1p is homologous to mammalian OST48 [].; GO: 0004579 dolichyl-diphosphooligosaccharide-protein glycotransferase activity, 0018279 protein N-linked glycosylation via asparagine, 0005789 endoplasmic reticulum membrane
Probab=20.81  E-value=41  Score=31.15  Aligned_cols=28  Identities=21%  Similarity=0.475  Sum_probs=23.5

Q ss_pred             CCCCChhHHHHHHHHHHHHHHHHHHHHH
Q 042254           29 PWHSPVPYLFGGLAAMLGLIAFALLILA   56 (159)
Q Consensus        29 ~W~SPvPYLFgGLA~MLgLIAvALLILA   56 (159)
                      .-.+--||+.+.+..|+|.|.|.++.|-
T Consensus       382 fI~~A~PYyas~~s~m~gf~lF~~~fL~  409 (423)
T PF03345_consen  382 FITNAYPYYASAFSMMIGFFLFVFVFLY  409 (423)
T ss_pred             ccccccHHHHHHHHHHHHHHhheeeEEE
Confidence            3446679999999999999998887775


No 122
>PHA03231 glycoprotein BALF4; Provisional
Probab=20.79  E-value=80  Score=32.04  Aligned_cols=36  Identities=28%  Similarity=0.342  Sum_probs=24.6

Q ss_pred             cccccCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHhhhc
Q 042254           21 TVATQQRSPWHSPVPYLFGGLAAMLGLIAFALLILACSYW   60 (159)
Q Consensus        21 ~~~~~~~s~W~SPvPYLFgGLA~MLgLIAvALLILACSy~   60 (159)
                      +-+.+-.+..+-|    ||||+.+|.+||+-++|+.-.+|
T Consensus       691 SiVsG~~sFl~NP----FGg~~iillvia~vv~v~l~~rr  726 (829)
T PHA03231        691 SIVSGVISFLKNP----FGGLAIGLLVIAVLVAVFLAYRR  726 (829)
T ss_pred             HHHHHHHHHhcCc----hHHHHHHHHHHHHhhhhhHHHHH
Confidence            3334445777777    89999988888877666554444


No 123
>PF08693 SKG6:  Transmembrane alpha-helix domain;  InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ]. This entry represents the highly conserved transmembrane alpha-helical domain found in these proteins [, ]. The full-length AXL2 protein has a negative regulatory function in cytokinesis [].
Probab=20.77  E-value=77  Score=20.76  Aligned_cols=17  Identities=18%  Similarity=0.421  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHhhhcc
Q 042254           45 LGLIAFALLILACSYWK   61 (159)
Q Consensus        45 LgLIAvALLILACSy~K   61 (159)
                      +++|++.|+++.|-.||
T Consensus        21 V~vI~~vl~~~l~~~~r   37 (40)
T PF08693_consen   21 VGVIIIVLGAFLFFWYR   37 (40)
T ss_pred             hHHHHHHHHHHhheEEe
Confidence            56677777666665444


No 124
>PF04961 FTCD_C:  Formiminotransferase-cyclodeaminase;  InterPro: IPR007044 Enzymes containing the cyclodeaminase domain function in channeling one-carbon units to the folate pool. In most cases, this domain catalyses the cyclisation of formimidoyltetrahydrofolate to methenyltetrahydrofolate as shown in reaction (1). In the methylotrophic bacterium Methylobacterium extorquens, however, it catalyses the interconversion of formyltetrahydrofolate and methylenetetrahydrofolate [],as shown in reaction (2) (1) 5-formimidoyltetrahydrofolate = 5,10-methenyltetrahydrofolate + NH(3) (2) 10- formyltetrahydrofolate = 5,10-methenyltetrahydrofolate + H(2)O In prokaryotes, this domain mostly occurs on its own, while in eukaryotes it is fused to a glutamate formiminotransferase domain (which catalyses the previous step in the pathway) to form the bifunctional enzyme formiminotransferase-cyclodeaminase []. The eukaryotic enzyme is a circular tetramer of homodimers [], while the prokaryotic enzyme is a dimer [, ].  The crystal structure of the cyclodeaminase enzyme (Q9X1P6 from SWISSPROT) from Thermaotogoa maritima has been studied []. It is a homodimer, where each monomer is composed of six alpha helices arranged in an up and down helical bundle, forming a novel fold. The location of the active site is not known, but sequence alignments revealed two clusters of conserved residues located in a deep pocket within the dimmer interface. This pocket was large enough to accommodate the reaction product and it was postulated that this is the active site.; GO: 0003824 catalytic activity, 0044237 cellular metabolic process; PDB: 2PFD_C 1O5H_B.
Probab=20.69  E-value=1.2e+02  Score=24.57  Aligned_cols=22  Identities=27%  Similarity=0.285  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHHHhhhc
Q 042254           39 GGLAAMLGLIAFALLILACSYW   60 (159)
Q Consensus        39 gGLA~MLgLIAvALLILACSy~   60 (159)
                      |+.+++.|-++.||+.++|-+-
T Consensus        20 GsaaAl~gAlgaaL~~Mv~~lT   41 (184)
T PF04961_consen   20 GSAAALSGALGAALGSMVANLT   41 (184)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            6678999999999999999754


No 125
>PF13623 SurA_N_2:  SurA N-terminal domain
Probab=20.66  E-value=89  Score=24.61  Aligned_cols=17  Identities=18%  Similarity=0.288  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHhhh
Q 042254           43 AMLGLIAFALLILACSY   59 (159)
Q Consensus        43 ~MLgLIAvALLILACSy   59 (159)
                      +++++|++||+...-+-
T Consensus        10 lLi~vIglAL~aFIv~d   26 (145)
T PF13623_consen   10 LLIIVIGLALFAFIVGD   26 (145)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            35567777777666553


No 126
>COG5042 NUP Purine nucleoside permease [Nucleotide transport and metabolism]
Probab=20.50  E-value=52  Score=30.15  Aligned_cols=24  Identities=29%  Similarity=-0.003  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhhc
Q 042254           37 LFGGLAAMLGLIAFALLILACSYW   60 (159)
Q Consensus        37 LFgGLA~MLgLIAvALLILACSy~   60 (159)
                      +-.||.+|+||-|.|..+-.|++.
T Consensus        13 va~~lll~~g~~a~A~~~~~k~v~   36 (349)
T COG5042          13 VALGLLLALGLGASAHAQAKKPVP   36 (349)
T ss_pred             HHHHHHHHhcccccccccccCCCC
Confidence            334556666666666655555443


No 127
>PF11239 DUF3040:  Protein of unknown function (DUF3040);  InterPro: IPR021401  Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. 
Probab=20.28  E-value=2.5e+02  Score=19.70  Aligned_cols=24  Identities=25%  Similarity=0.267  Sum_probs=13.0

Q ss_pred             CCCCCCCChhHHHHHHHHHHHHHH
Q 042254           26 QRSPWHSPVPYLFGGLAAMLGLIA   49 (159)
Q Consensus        26 ~~s~W~SPvPYLFgGLA~MLgLIA   49 (159)
                      +...+.++-.++.+.+.+.+||+.
T Consensus        32 ~~~~~~~~r~~~~~~~~~v~gl~l   55 (82)
T PF11239_consen   32 GRPRRPSRRRRVLGVLLVVVGLAL   55 (82)
T ss_pred             CCCCCCchhHHHHHHHHHHHHHHH
Confidence            344555555556666655555433


No 128
>PF06387 Calcyon:  D1 dopamine receptor-interacting protein (calcyon);  InterPro: IPR009431 This family consists of several D1 dopamine receptor-interacting (calcyon) proteins. D1/D5 dopamine receptors in the basal ganglia, hippocampus, and cerebral cortex modulate motor, reward, and cognitive behaviour. D1-like dopamine receptors likely modulate neocortical and hippocampal neuronal excitability and synaptic function via Ca2+ as well as cAMP-dependent signalling []. Defective calcyon proteins have been implicated in both attention-deficit/hyperactivity disorder (ADHD) [] and schizophrenia.; GO: 0050780 dopamine receptor binding, 0007212 dopamine receptor signaling pathway, 0016021 integral to membrane
Probab=20.26  E-value=73  Score=27.06  Aligned_cols=14  Identities=57%  Similarity=0.864  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHhh
Q 042254           45 LGLIAFALLILACS   58 (159)
Q Consensus        45 LgLIAvALLILACS   58 (159)
                      -+||+|||..|+|-
T Consensus        85 t~lI~~alAfl~Cv   98 (186)
T PF06387_consen   85 TRLIAFALAFLGCV   98 (186)
T ss_pred             hHHHHHHHHHHHHH
Confidence            36788888888887


No 129
>PF04964 Flp_Fap:  Flp/Fap pilin component;  InterPro: IPR007047  This entry is for the fimbriae associated protein Flp/Fap pilin component.
Probab=20.13  E-value=92  Score=20.18  Aligned_cols=14  Identities=36%  Similarity=0.465  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHHH
Q 042254           42 AAMLGLIAFALLIL   55 (159)
Q Consensus        42 A~MLgLIAvALLIL   55 (159)
                      |+|++||+++++.-
T Consensus        14 ali~alia~~ii~~   27 (46)
T PF04964_consen   14 ALIAALIAVAIIAA   27 (46)
T ss_pred             HHHHHHHHHHHHHH
Confidence            56777777777643


Done!