BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042256
         (196 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1X0U|A Chain A, Crystal Structure Of The Carboxyl Transferase Subunit Of
           Putative Pcc Of Sulfolobus Tokodaii
 pdb|1X0U|B Chain B, Crystal Structure Of The Carboxyl Transferase Subunit Of
           Putative Pcc Of Sulfolobus Tokodaii
 pdb|1X0U|C Chain C, Crystal Structure Of The Carboxyl Transferase Subunit Of
           Putative Pcc Of Sulfolobus Tokodaii
 pdb|1X0U|D Chain D, Crystal Structure Of The Carboxyl Transferase Subunit Of
           Putative Pcc Of Sulfolobus Tokodaii
 pdb|1X0U|E Chain E, Crystal Structure Of The Carboxyl Transferase Subunit Of
           Putative Pcc Of Sulfolobus Tokodaii
 pdb|1X0U|F Chain F, Crystal Structure Of The Carboxyl Transferase Subunit Of
           Putative Pcc Of Sulfolobus Tokodaii
          Length = 522

 Score = 28.9 bits (63), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 38  PKLPVFHLQSFSFRHFNVSVKSDGTYL-HAATLTRVEARNPNGKLRYYYR 86
           PK+ V   +S+   H  +S+KS G  L +A     +    P G +R  YR
Sbjct: 400 PKITVIVRKSYGGAHIAMSIKSLGADLVYAWPTAEIAVTGPEGAVRILYR 449


>pdb|1OA8|A Chain A, Axh Domain Of Human Spinocerebellar Ataxin-1
 pdb|1OA8|B Chain B, Axh Domain Of Human Spinocerebellar Ataxin-1
 pdb|1OA8|C Chain C, Axh Domain Of Human Spinocerebellar Ataxin-1
 pdb|1OA8|D Chain D, Axh Domain Of Human Spinocerebellar Ataxin-1
          Length = 133

 Score = 26.9 bits (58), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 83  YYYRHTDVEVTAGKDKEI-DLGTGSVPGFTQGTKNARSLKIETKTDELVEDGMGP 136
           Y+ + + +++  G+ K++ DL T     F Q  + +  LKI++ T E +ED   P
Sbjct: 13  YFMKGSIIQLANGELKKVEDLKT---EDFIQSAEISNDLKIDSSTVERIEDSHSP 64


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,014,011
Number of Sequences: 62578
Number of extensions: 187756
Number of successful extensions: 618
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 618
Number of HSP's gapped (non-prelim): 2
length of query: 196
length of database: 14,973,337
effective HSP length: 94
effective length of query: 102
effective length of database: 9,091,005
effective search space: 927282510
effective search space used: 927282510
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)