BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 042256
(196 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1X0U|A Chain A, Crystal Structure Of The Carboxyl Transferase Subunit Of
Putative Pcc Of Sulfolobus Tokodaii
pdb|1X0U|B Chain B, Crystal Structure Of The Carboxyl Transferase Subunit Of
Putative Pcc Of Sulfolobus Tokodaii
pdb|1X0U|C Chain C, Crystal Structure Of The Carboxyl Transferase Subunit Of
Putative Pcc Of Sulfolobus Tokodaii
pdb|1X0U|D Chain D, Crystal Structure Of The Carboxyl Transferase Subunit Of
Putative Pcc Of Sulfolobus Tokodaii
pdb|1X0U|E Chain E, Crystal Structure Of The Carboxyl Transferase Subunit Of
Putative Pcc Of Sulfolobus Tokodaii
pdb|1X0U|F Chain F, Crystal Structure Of The Carboxyl Transferase Subunit Of
Putative Pcc Of Sulfolobus Tokodaii
Length = 522
Score = 28.9 bits (63), Expect = 2.2, Method: Compositional matrix adjust.
Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
Query: 38 PKLPVFHLQSFSFRHFNVSVKSDGTYL-HAATLTRVEARNPNGKLRYYYR 86
PK+ V +S+ H +S+KS G L +A + P G +R YR
Sbjct: 400 PKITVIVRKSYGGAHIAMSIKSLGADLVYAWPTAEIAVTGPEGAVRILYR 449
>pdb|1OA8|A Chain A, Axh Domain Of Human Spinocerebellar Ataxin-1
pdb|1OA8|B Chain B, Axh Domain Of Human Spinocerebellar Ataxin-1
pdb|1OA8|C Chain C, Axh Domain Of Human Spinocerebellar Ataxin-1
pdb|1OA8|D Chain D, Axh Domain Of Human Spinocerebellar Ataxin-1
Length = 133
Score = 26.9 bits (58), Expect = 7.2, Method: Compositional matrix adjust.
Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 4/55 (7%)
Query: 83 YYYRHTDVEVTAGKDKEI-DLGTGSVPGFTQGTKNARSLKIETKTDELVEDGMGP 136
Y+ + + +++ G+ K++ DL T F Q + + LKI++ T E +ED P
Sbjct: 13 YFMKGSIIQLANGELKKVEDLKT---EDFIQSAEISNDLKIDSSTVERIEDSHSP 64
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.135 0.412
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,014,011
Number of Sequences: 62578
Number of extensions: 187756
Number of successful extensions: 618
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 618
Number of HSP's gapped (non-prelim): 2
length of query: 196
length of database: 14,973,337
effective HSP length: 94
effective length of query: 102
effective length of database: 9,091,005
effective search space: 927282510
effective search space used: 927282510
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)