BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042316
         (90 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q90688|MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus GN=MYBPC3
           PE=1 SV=3
          Length = 1272

 Score = 29.6 bits (65), Expect = 6.0,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 34  LIHQHAKNSLRSVSQAKKLSTSSSALVSSNNKVREEK 70
           L+HQ  ++SL     +  LST S  L  S  +VR EK
Sbjct: 691 LVHQSNEDSLTPSENSSDLSTDSKLLFESEGRVRVEK 727


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.311    0.119    0.336 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,902,965
Number of Sequences: 539616
Number of extensions: 646572
Number of successful extensions: 2659
Number of sequences better than 100.0: 20
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 2646
Number of HSP's gapped (non-prelim): 22
length of query: 90
length of database: 191,569,459
effective HSP length: 60
effective length of query: 30
effective length of database: 159,192,499
effective search space: 4775774970
effective search space used: 4775774970
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 55 (25.8 bits)