Query         042316
Match_columns 90
No_of_seqs    100 out of 120
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 05:02:21 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042316.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042316hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00165 hypothetical protein; 100.0 3.5E-53 7.6E-58  283.7   5.6   88    1-90      1-88  (88)
  2 PF12609 DUF3774:  Wound-induce 100.0 5.5E-42 1.2E-46  224.6   3.4   77   10-89      1-79  (79)
  3 KOG4195 Transient receptor pot  58.4     3.8 8.2E-05   32.5   0.4   15   76-90     98-112 (275)
  4 PF06554 Olfactory_mark:  Olfac  23.0      39 0.00085   24.8   0.8    9   76-84    122-130 (151)
  5 PF06449 DUF1082:  Mitochondria  21.7      51  0.0011   20.3   1.0   11   79-89      7-17  (51)
  6 PF10406 TAF8_C:  Transcription  21.2      35 0.00076   20.2   0.2   14   69-82     38-51  (51)
  7 PHA00665 major capsid protein   17.3      71  0.0015   26.2   1.2   12   79-90    169-180 (329)
  8 PF13540 RCC1_2:  Regulator of   17.0      52  0.0011   17.1   0.3    7   84-90     20-26  (30)
  9 PF02083 Urotensin_II:  Urotens  16.2      47   0.001   14.9  -0.0    7   25-31      5-11  (12)
 10 PF02284 COX5A:  Cytochrome c o  15.7 1.4E+02  0.0031   20.9   2.2   26   10-35     61-89  (108)

No 1  
>PLN00165 hypothetical protein; Provisional
Probab=100.00  E-value=3.5e-53  Score=283.67  Aligned_cols=88  Identities=76%  Similarity=1.146  Sum_probs=79.8

Q ss_pred             CCcchhHHHHHHHHHHHHHhccccccccchhHHHHHHHHHhhhhhhhhhcccCCchhhhhhccchhhhhhhhhhhhhhcc
Q 042316            1 MSSTSRAWMVAASVAAVEVLKDQGFCRWNYPIRLIHQHAKNSLRSVSQAKKLSTSSSALVSSNNKVREEKAKQSEESMRK   80 (90)
Q Consensus         1 Ms~~~~~w~vAaSvgaVealKDQG~Crwn~alrSl~~~ak~~~~s~sqa~~ls~sssa~~~~~~~~~~~k~kqaEESLR~   80 (90)
                      |||++|+||||+||||||+|||||+|||||+|||||||++++++|++|+++|++++++..+  ...+++|.||+||||||
T Consensus         1 Ms~~~r~w~vAaSvgaVEalkDQG~cRwny~lrS~~~~a~~~~~s~s~~~~lss~~~~~~s--~~~~~~k~kq~EEsLRt   78 (88)
T PLN00165          1 MSHMGKAWIVAASVGAVEALKDQGFCRWNYTLRSIHQHAKNNLRSFSQAKKLSSSSSAMVS--SRVREEKAKQSEESLRT   78 (88)
T ss_pred             CccchhHHHHHHHHHHHhhccccCeeehhhHHHHHHHHHHhccccccccccCCCcchhhhh--hhhccccccchHHhhhe
Confidence            9999999999999999999999999999999999999999999999999999876543322  34566888999999999


Q ss_pred             eeeeecccCC
Q 042316           81 VIYLSSWGPY   90 (90)
Q Consensus        81 VMyLSCWGPn   90 (90)
                      ||||||||||
T Consensus        79 VMyLSCWGPN   88 (88)
T PLN00165         79 VMYLSCWGPN   88 (88)
T ss_pred             eeEecccCCC
Confidence            9999999998


No 2  
>PF12609 DUF3774:  Wound-induced protein;  InterPro: IPR022251  This family of proteins is found in eukaryotes. Proteins in this family are typically between 81 and 97 amino acids in length. The proteins in the family are often annotated as wound-induced proteins however there is little accompanying literature to confirm this. 
Probab=100.00  E-value=5.5e-42  Score=224.58  Aligned_cols=77  Identities=66%  Similarity=1.004  Sum_probs=68.3

Q ss_pred             HHHHHHHHHHhccc-cccccchhHHHHHHHHHhhh-hhhhhhcccCCchhhhhhccchhhhhhhhhhhhhhcceeeeecc
Q 042316           10 VAASVAAVEVLKDQ-GFCRWNYPIRLIHQHAKNSL-RSVSQAKKLSTSSSALVSSNNKVREEKAKQSEESMRKVIYLSSW   87 (90)
Q Consensus        10 vAaSvgaVealKDQ-G~Crwn~alrSl~~~ak~~~-~s~sqa~~ls~sssa~~~~~~~~~~~k~kqaEESLR~VMyLSCW   87 (90)
                      ||+||||||+|||| |+|||||+|||+|+++++++ ++.+|++++++++++. .  ....+++.||+|||||||||||||
T Consensus         1 vAasvgavealKDq~g~crwn~alrs~~~~a~~~~~~s~~~~~~~~ss~~~~-~--~~~~~~~~k~aEEsLRtVMyLSCW   77 (79)
T PF12609_consen    1 VAASVGAVEALKDQAGLCRWNYALRSLHQHAKANVRGSASQAKRLSSSSSSS-S--AAAEEEKRKQAEESLRTVMYLSCW   77 (79)
T ss_pred             CchhHHHHhccccccccccccHHHHHHHHHhhhccccccccccccCcccccc-c--ccccccccchhhhhhceeEEEecc
Confidence            68999999999999 99999999999999999999 8899999987765421 1  245678999999999999999999


Q ss_pred             cC
Q 042316           88 GP   89 (90)
Q Consensus        88 GP   89 (90)
                      ||
T Consensus        78 GP   79 (79)
T PF12609_consen   78 GP   79 (79)
T ss_pred             Cc
Confidence            99


No 3  
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism]
Probab=58.45  E-value=3.8  Score=32.54  Aligned_cols=15  Identities=33%  Similarity=0.656  Sum_probs=11.1

Q ss_pred             hhhcceeeeecccCC
Q 042316           76 ESMRKVIYLSSWGPY   90 (90)
Q Consensus        76 ESLR~VMyLSCWGPn   90 (90)
                      -.||--=-|+|||||
T Consensus        98 TGL~GRG~LgrwGPN  112 (275)
T KOG4195|consen   98 TGLRGRGSLGRWGPN  112 (275)
T ss_pred             ccccccccccccCCc
Confidence            345555679999998


No 4  
>PF06554 Olfactory_mark:  Olfactory marker protein;  InterPro: IPR009103 Olfactory marker protein (OMP) is a highly expressed, cytoplasmic protein found in mature olfactory sensory receptor neurons of all vertebrates. OMP is a modulator of the olfactory signal transduction cascade. The crystal structure of OMP reveals a beta sandwich consisting of eight strands in two sheets with a jelly-roll topology []. Three highly conserved regions have been identified as possible protein-protein interaction sites in OMP, indicating a possible role for OMP in modulating such interactions, thereby acting as a molecular switch [].; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0007608 sensory perception of smell; PDB: 1ZRI_A 1JYT_A 1JOD_B 1F35_A 1JOB_A.
Probab=23.05  E-value=39  Score=24.85  Aligned_cols=9  Identities=44%  Similarity=0.969  Sum_probs=7.6

Q ss_pred             hhhcceeee
Q 042316           76 ESMRKVIYL   84 (90)
Q Consensus        76 ESLR~VMyL   84 (90)
                      ...|||||+
T Consensus       122 AKiRKVMYF  130 (151)
T PF06554_consen  122 AKIRKVMYF  130 (151)
T ss_dssp             HHCTTEEEE
T ss_pred             HHHHhhhee
Confidence            468999997


No 5  
>PF06449 DUF1082:  Mitochondrial domain of unknown function (DUF1082);  InterPro: IPR009455 The domain is found exclusively in plant mitochonchria and is a putative homing endonuclease, though such a function remains to be demonstrated. The domain is found C-terminal to the plant mitochondrial ATPase subunit 8 domain IPR003319 from INTERPRO.; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0005739 mitochondrion, 0016021 integral to membrane
Probab=21.72  E-value=51  Score=20.25  Aligned_cols=11  Identities=36%  Similarity=0.763  Sum_probs=9.3

Q ss_pred             cceeeeecccC
Q 042316           79 RKVIYLSSWGP   89 (90)
Q Consensus        79 R~VMyLSCWGP   89 (90)
                      |++-|+||+|-
T Consensus         7 ~kit~iscFGE   17 (51)
T PF06449_consen    7 RKITLISCFGE   17 (51)
T ss_pred             eEEEEEEEece
Confidence            68899999984


No 6  
>PF10406 TAF8_C:  Transcription factor TFIID complex subunit 8 C-term ;  InterPro: IPR019473  This entry represents the C-terminal region of subunit 8 (also known as TAF8) of the transcription factor TFIID []. The adjacent N-terminal region generally contains a histone fold domain (IPR006565 from INTERPRO). This subunit is one of the key subunits of TFIID, being one of several general cofactors which are typically involved in gene activation to bring about the communication between gene-specific transcription factors and components of the general transcription machinery []. 
Probab=21.16  E-value=35  Score=20.25  Aligned_cols=14  Identities=29%  Similarity=0.705  Sum_probs=10.2

Q ss_pred             hhhhhhhhhhccee
Q 042316           69 EKAKQSEESMRKVI   82 (90)
Q Consensus        69 ~k~kqaEESLR~VM   82 (90)
                      +..+++|++|++.|
T Consensus        38 ~~~r~~e~aL~~l~   51 (51)
T PF10406_consen   38 EQSRLAEKALRKLL   51 (51)
T ss_pred             HHHHHHHHHHHHhC
Confidence            34567899998765


No 7  
>PHA00665 major capsid protein
Probab=17.35  E-value=71  Score=26.22  Aligned_cols=12  Identities=42%  Similarity=0.999  Sum_probs=10.3

Q ss_pred             cceeeeecccCC
Q 042316           79 RKVIYLSSWGPY   90 (90)
Q Consensus        79 R~VMyLSCWGPn   90 (90)
                      -|=.||-+||||
T Consensus       169 ~tSiwlv~wg~~  180 (329)
T PHA00665        169 NASIWLVVWGPN  180 (329)
T ss_pred             cceEEEEEEcCC
Confidence            367899999997


No 8  
>PF13540 RCC1_2:  Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=17.04  E-value=52  Score=17.08  Aligned_cols=7  Identities=29%  Similarity=0.890  Sum_probs=3.6

Q ss_pred             eecccCC
Q 042316           84 LSSWGPY   90 (90)
Q Consensus        84 LSCWGPn   90 (90)
                      |-|||-|
T Consensus        20 v~~wG~n   26 (30)
T PF13540_consen   20 VYCWGDN   26 (30)
T ss_dssp             EEEEE--
T ss_pred             EEEEcCC
Confidence            5688764


No 9  
>PF02083 Urotensin_II:  Urotensin II;  InterPro: IPR001483 Urotensin II, a small peptide that contains a disulphide bridge, was originally isolated from the caudal portion of the spinal cord of teleost and elasmobranch fish []. The peptide has also been found in the brain of frogs []. Urotensin II seems to be involved in smooth muscle stimulation.; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=16.17  E-value=47  Score=14.93  Aligned_cols=7  Identities=43%  Similarity=1.146  Sum_probs=5.0

Q ss_pred             ccccchh
Q 042316           25 FCRWNYP   31 (90)
Q Consensus        25 ~Crwn~a   31 (90)
                      -|-|+|-
T Consensus         5 ~CFWKYC   11 (12)
T PF02083_consen    5 ECFWKYC   11 (12)
T ss_pred             chhhhhc
Confidence            4889873


No 10 
>PF02284 COX5A:  Cytochrome c oxidase subunit Va;  InterPro: IPR003204 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits is known as Va.; GO: 0004129 cytochrome-c oxidase activity; PDB: 2DYR_R 3AG1_E 3ABL_E 1V54_R 2EIJ_R 1OCR_E 2DYS_E 2EIM_E 2OCC_E 3ASN_R ....
Probab=15.69  E-value=1.4e+02  Score=20.88  Aligned_cols=26  Identities=27%  Similarity=0.447  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHhccc-cccc--cchhHHHH
Q 042316           10 VAASVAAVEVLKDQ-GFCR--WNYPIRLI   35 (90)
Q Consensus        10 vAaSvgaVealKDQ-G~Cr--wn~alrSl   35 (90)
                      .|++|...|++||. |...  |.|-|.-|
T Consensus        61 ~a~AVR~lE~iK~K~~~~~~~Y~~~lqEl   89 (108)
T PF02284_consen   61 FALAVRILEGIKDKCGNKKEIYPYILQEL   89 (108)
T ss_dssp             HHHHHHHHHHHHHHTTT-TTHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHccChHHHHHHHHHHH
Confidence            57889999999998 6554  44544433


Done!