Query 042316
Match_columns 90
No_of_seqs 100 out of 120
Neff 4.3
Searched_HMMs 46136
Date Fri Mar 29 05:02:21 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042316.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042316hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PLN00165 hypothetical protein; 100.0 3.5E-53 7.6E-58 283.7 5.6 88 1-90 1-88 (88)
2 PF12609 DUF3774: Wound-induce 100.0 5.5E-42 1.2E-46 224.6 3.4 77 10-89 1-79 (79)
3 KOG4195 Transient receptor pot 58.4 3.8 8.2E-05 32.5 0.4 15 76-90 98-112 (275)
4 PF06554 Olfactory_mark: Olfac 23.0 39 0.00085 24.8 0.8 9 76-84 122-130 (151)
5 PF06449 DUF1082: Mitochondria 21.7 51 0.0011 20.3 1.0 11 79-89 7-17 (51)
6 PF10406 TAF8_C: Transcription 21.2 35 0.00076 20.2 0.2 14 69-82 38-51 (51)
7 PHA00665 major capsid protein 17.3 71 0.0015 26.2 1.2 12 79-90 169-180 (329)
8 PF13540 RCC1_2: Regulator of 17.0 52 0.0011 17.1 0.3 7 84-90 20-26 (30)
9 PF02083 Urotensin_II: Urotens 16.2 47 0.001 14.9 -0.0 7 25-31 5-11 (12)
10 PF02284 COX5A: Cytochrome c o 15.7 1.4E+02 0.0031 20.9 2.2 26 10-35 61-89 (108)
No 1
>PLN00165 hypothetical protein; Provisional
Probab=100.00 E-value=3.5e-53 Score=283.67 Aligned_cols=88 Identities=76% Similarity=1.146 Sum_probs=79.8
Q ss_pred CCcchhHHHHHHHHHHHHHhccccccccchhHHHHHHHHHhhhhhhhhhcccCCchhhhhhccchhhhhhhhhhhhhhcc
Q 042316 1 MSSTSRAWMVAASVAAVEVLKDQGFCRWNYPIRLIHQHAKNSLRSVSQAKKLSTSSSALVSSNNKVREEKAKQSEESMRK 80 (90)
Q Consensus 1 Ms~~~~~w~vAaSvgaVealKDQG~Crwn~alrSl~~~ak~~~~s~sqa~~ls~sssa~~~~~~~~~~~k~kqaEESLR~ 80 (90)
|||++|+||||+||||||+|||||+|||||+|||||||++++++|++|+++|++++++..+ ...+++|.||+||||||
T Consensus 1 Ms~~~r~w~vAaSvgaVEalkDQG~cRwny~lrS~~~~a~~~~~s~s~~~~lss~~~~~~s--~~~~~~k~kq~EEsLRt 78 (88)
T PLN00165 1 MSHMGKAWIVAASVGAVEALKDQGFCRWNYTLRSIHQHAKNNLRSFSQAKKLSSSSSAMVS--SRVREEKAKQSEESLRT 78 (88)
T ss_pred CccchhHHHHHHHHHHHhhccccCeeehhhHHHHHHHHHHhccccccccccCCCcchhhhh--hhhccccccchHHhhhe
Confidence 9999999999999999999999999999999999999999999999999999876543322 34566888999999999
Q ss_pred eeeeecccCC
Q 042316 81 VIYLSSWGPY 90 (90)
Q Consensus 81 VMyLSCWGPn 90 (90)
||||||||||
T Consensus 79 VMyLSCWGPN 88 (88)
T PLN00165 79 VMYLSCWGPN 88 (88)
T ss_pred eeEecccCCC
Confidence 9999999998
No 2
>PF12609 DUF3774: Wound-induced protein; InterPro: IPR022251 This family of proteins is found in eukaryotes. Proteins in this family are typically between 81 and 97 amino acids in length. The proteins in the family are often annotated as wound-induced proteins however there is little accompanying literature to confirm this.
Probab=100.00 E-value=5.5e-42 Score=224.58 Aligned_cols=77 Identities=66% Similarity=1.004 Sum_probs=68.3
Q ss_pred HHHHHHHHHHhccc-cccccchhHHHHHHHHHhhh-hhhhhhcccCCchhhhhhccchhhhhhhhhhhhhhcceeeeecc
Q 042316 10 VAASVAAVEVLKDQ-GFCRWNYPIRLIHQHAKNSL-RSVSQAKKLSTSSSALVSSNNKVREEKAKQSEESMRKVIYLSSW 87 (90)
Q Consensus 10 vAaSvgaVealKDQ-G~Crwn~alrSl~~~ak~~~-~s~sqa~~ls~sssa~~~~~~~~~~~k~kqaEESLR~VMyLSCW 87 (90)
||+||||||+|||| |+|||||+|||+|+++++++ ++.+|++++++++++. . ....+++.||+|||||||||||||
T Consensus 1 vAasvgavealKDq~g~crwn~alrs~~~~a~~~~~~s~~~~~~~~ss~~~~-~--~~~~~~~~k~aEEsLRtVMyLSCW 77 (79)
T PF12609_consen 1 VAASVGAVEALKDQAGLCRWNYALRSLHQHAKANVRGSASQAKRLSSSSSSS-S--AAAEEEKRKQAEESLRTVMYLSCW 77 (79)
T ss_pred CchhHHHHhccccccccccccHHHHHHHHHhhhccccccccccccCcccccc-c--ccccccccchhhhhhceeEEEecc
Confidence 68999999999999 99999999999999999999 8899999987765421 1 245678999999999999999999
Q ss_pred cC
Q 042316 88 GP 89 (90)
Q Consensus 88 GP 89 (90)
||
T Consensus 78 GP 79 (79)
T PF12609_consen 78 GP 79 (79)
T ss_pred Cc
Confidence 99
No 3
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism]
Probab=58.45 E-value=3.8 Score=32.54 Aligned_cols=15 Identities=33% Similarity=0.656 Sum_probs=11.1
Q ss_pred hhhcceeeeecccCC
Q 042316 76 ESMRKVIYLSSWGPY 90 (90)
Q Consensus 76 ESLR~VMyLSCWGPn 90 (90)
-.||--=-|+|||||
T Consensus 98 TGL~GRG~LgrwGPN 112 (275)
T KOG4195|consen 98 TGLRGRGSLGRWGPN 112 (275)
T ss_pred ccccccccccccCCc
Confidence 345555679999998
No 4
>PF06554 Olfactory_mark: Olfactory marker protein; InterPro: IPR009103 Olfactory marker protein (OMP) is a highly expressed, cytoplasmic protein found in mature olfactory sensory receptor neurons of all vertebrates. OMP is a modulator of the olfactory signal transduction cascade. The crystal structure of OMP reveals a beta sandwich consisting of eight strands in two sheets with a jelly-roll topology []. Three highly conserved regions have been identified as possible protein-protein interaction sites in OMP, indicating a possible role for OMP in modulating such interactions, thereby acting as a molecular switch [].; GO: 0004871 signal transducer activity, 0007165 signal transduction, 0007608 sensory perception of smell; PDB: 1ZRI_A 1JYT_A 1JOD_B 1F35_A 1JOB_A.
Probab=23.05 E-value=39 Score=24.85 Aligned_cols=9 Identities=44% Similarity=0.969 Sum_probs=7.6
Q ss_pred hhhcceeee
Q 042316 76 ESMRKVIYL 84 (90)
Q Consensus 76 ESLR~VMyL 84 (90)
...|||||+
T Consensus 122 AKiRKVMYF 130 (151)
T PF06554_consen 122 AKIRKVMYF 130 (151)
T ss_dssp HHCTTEEEE
T ss_pred HHHHhhhee
Confidence 468999997
No 5
>PF06449 DUF1082: Mitochondrial domain of unknown function (DUF1082); InterPro: IPR009455 The domain is found exclusively in plant mitochonchria and is a putative homing endonuclease, though such a function remains to be demonstrated. The domain is found C-terminal to the plant mitochondrial ATPase subunit 8 domain IPR003319 from INTERPRO.; GO: 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0005739 mitochondrion, 0016021 integral to membrane
Probab=21.72 E-value=51 Score=20.25 Aligned_cols=11 Identities=36% Similarity=0.763 Sum_probs=9.3
Q ss_pred cceeeeecccC
Q 042316 79 RKVIYLSSWGP 89 (90)
Q Consensus 79 R~VMyLSCWGP 89 (90)
|++-|+||+|-
T Consensus 7 ~kit~iscFGE 17 (51)
T PF06449_consen 7 RKITLISCFGE 17 (51)
T ss_pred eEEEEEEEece
Confidence 68899999984
No 6
>PF10406 TAF8_C: Transcription factor TFIID complex subunit 8 C-term ; InterPro: IPR019473 This entry represents the C-terminal region of subunit 8 (also known as TAF8) of the transcription factor TFIID []. The adjacent N-terminal region generally contains a histone fold domain (IPR006565 from INTERPRO). This subunit is one of the key subunits of TFIID, being one of several general cofactors which are typically involved in gene activation to bring about the communication between gene-specific transcription factors and components of the general transcription machinery [].
Probab=21.16 E-value=35 Score=20.25 Aligned_cols=14 Identities=29% Similarity=0.705 Sum_probs=10.2
Q ss_pred hhhhhhhhhhccee
Q 042316 69 EKAKQSEESMRKVI 82 (90)
Q Consensus 69 ~k~kqaEESLR~VM 82 (90)
+..+++|++|++.|
T Consensus 38 ~~~r~~e~aL~~l~ 51 (51)
T PF10406_consen 38 EQSRLAEKALRKLL 51 (51)
T ss_pred HHHHHHHHHHHHhC
Confidence 34567899998765
No 7
>PHA00665 major capsid protein
Probab=17.35 E-value=71 Score=26.22 Aligned_cols=12 Identities=42% Similarity=0.999 Sum_probs=10.3
Q ss_pred cceeeeecccCC
Q 042316 79 RKVIYLSSWGPY 90 (90)
Q Consensus 79 R~VMyLSCWGPn 90 (90)
-|=.||-+||||
T Consensus 169 ~tSiwlv~wg~~ 180 (329)
T PHA00665 169 NASIWLVVWGPN 180 (329)
T ss_pred cceEEEEEEcCC
Confidence 367899999997
No 8
>PF13540 RCC1_2: Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=17.04 E-value=52 Score=17.08 Aligned_cols=7 Identities=29% Similarity=0.890 Sum_probs=3.6
Q ss_pred eecccCC
Q 042316 84 LSSWGPY 90 (90)
Q Consensus 84 LSCWGPn 90 (90)
|-|||-|
T Consensus 20 v~~wG~n 26 (30)
T PF13540_consen 20 VYCWGDN 26 (30)
T ss_dssp EEEEE--
T ss_pred EEEEcCC
Confidence 5688764
No 9
>PF02083 Urotensin_II: Urotensin II; InterPro: IPR001483 Urotensin II, a small peptide that contains a disulphide bridge, was originally isolated from the caudal portion of the spinal cord of teleost and elasmobranch fish []. The peptide has also been found in the brain of frogs []. Urotensin II seems to be involved in smooth muscle stimulation.; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=16.17 E-value=47 Score=14.93 Aligned_cols=7 Identities=43% Similarity=1.146 Sum_probs=5.0
Q ss_pred ccccchh
Q 042316 25 FCRWNYP 31 (90)
Q Consensus 25 ~Crwn~a 31 (90)
-|-|+|-
T Consensus 5 ~CFWKYC 11 (12)
T PF02083_consen 5 ECFWKYC 11 (12)
T ss_pred chhhhhc
Confidence 4889873
No 10
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane. In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits is known as Va.; GO: 0004129 cytochrome-c oxidase activity; PDB: 2DYR_R 3AG1_E 3ABL_E 1V54_R 2EIJ_R 1OCR_E 2DYS_E 2EIM_E 2OCC_E 3ASN_R ....
Probab=15.69 E-value=1.4e+02 Score=20.88 Aligned_cols=26 Identities=27% Similarity=0.447 Sum_probs=17.7
Q ss_pred HHHHHHHHHHhccc-cccc--cchhHHHH
Q 042316 10 VAASVAAVEVLKDQ-GFCR--WNYPIRLI 35 (90)
Q Consensus 10 vAaSvgaVealKDQ-G~Cr--wn~alrSl 35 (90)
.|++|...|++||. |... |.|-|.-|
T Consensus 61 ~a~AVR~lE~iK~K~~~~~~~Y~~~lqEl 89 (108)
T PF02284_consen 61 FALAVRILEGIKDKCGNKKEIYPYILQEL 89 (108)
T ss_dssp HHHHHHHHHHHHHHTTT-TTHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHccChHHHHHHHHHHH
Confidence 57889999999998 6554 44544433
Done!