Query         042326
Match_columns 163
No_of_seqs    156 out of 1040
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 05:09:43 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042326.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042326hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03156 GDSL esterase/lipase;  99.8 5.8E-21 1.3E-25  164.3   4.6   55  109-163    26-80  (351)
  2 PRK15381 pathogenicity island   99.6 1.9E-15 4.2E-20  134.8   5.3   51  106-163   138-188 (408)
  3 COG3240 Phospholipase/lecithin  94.9   0.036 7.9E-07   50.5   4.3   24  106-129    25-48  (370)
  4 PF04834 Adeno_E3_14_5:  Early   36.2 1.1E+02  0.0025   23.5   5.3   29   37-65     23-64  (97)
  5 PF08282 Hydrolase_3:  haloacid  34.4      19 0.00041   27.2   0.8   16  110-125   202-217 (254)
  6 COG0561 Cof Predicted hydrolas  27.4      31 0.00067   27.7   1.0   18  110-127   205-222 (264)
  7 PRK10976 putative hydrolase; P  24.8      36 0.00078   27.3   1.0   17  110-126   206-222 (266)
  8 PRK10513 sugar phosphate phosp  24.7      35 0.00076   27.4   0.9   17  110-126   212-228 (270)
  9 TIGR01486 HAD-SF-IIB-MPGP mann  24.3      42 0.00092   27.1   1.3   18  110-127   194-211 (256)
 10 PRK03669 mannosyl-3-phosphogly  23.9      43 0.00093   27.4   1.3   17  109-125   205-221 (271)
 11 TIGR02463 MPGP_rel mannosyl-3-  23.8      40 0.00087   26.3   1.0   17  109-125   194-210 (221)
 12 TIGR01487 SPP-like sucrose-pho  23.1      37  0.0008   26.5   0.7   15  111-125   164-178 (215)
 13 PF12710 HAD:  haloacid dehalog  22.2      54  0.0012   24.3   1.4   15  109-123   174-188 (192)
 14 PRK01158 phosphoglycolate phos  22.2      42 0.00091   26.1   0.9   16  110-125   173-188 (230)
 15 PRK10528 multifunctional acyl-  20.9      61  0.0013   25.2   1.5   15  110-124    10-24  (191)
 16 PF15325 MRI:  Modulator of ret  20.6 4.3E+02  0.0094   20.8   6.3   11   38-48      9-19  (106)
 17 PRK15126 thiamin pyrimidine py  20.3      45 0.00097   27.0   0.7   17  109-125   203-219 (272)

No 1  
>PLN03156 GDSL esterase/lipase; Provisional
Probab=99.82  E-value=5.8e-21  Score=164.33  Aligned_cols=55  Identities=56%  Similarity=0.970  Sum_probs=50.5

Q ss_pred             CcCEEEEcCCcccccCCCcccccccCCCCCCCCCCCCCCCCCCCCCCCCCccccC
Q 042326          109 LVPALFVIGDSSVDSGTNNFLGTFARADRLPYGRDFDTHQPTGRFSNGRIPVDYL  163 (163)
Q Consensus       109 ~fpAIFvFGDSLSDTGNn~~l~t~~~a~~pPYGitffg~~PTGRFSDGRliiDFI  163 (163)
                      .+++||+||||++||||++++.+..+++++|||++|++++|||||||||+|+|||
T Consensus        26 ~~~aifvFGDSl~D~GN~~~l~~~~~~~~~pyG~~f~~~~ptGRfSnGr~~~D~i   80 (351)
T PLN03156         26 KVPAIIVFGDSSVDAGNNNQISTVAKSNFEPYGRDFPGGRPTGRFCNGRIAPDFI   80 (351)
T ss_pred             CCCEEEEecCcCccCCCccccccccccCCCCCCCCCCCCCCCccccCCChhhhhH
Confidence            3799999999999999998877666889999999999877999999999999996


No 2  
>PRK15381 pathogenicity island 2 effector protein SseJ; Provisional
Probab=99.57  E-value=1.9e-15  Score=134.81  Aligned_cols=51  Identities=35%  Similarity=0.402  Sum_probs=44.7

Q ss_pred             CCCCcCEEEEcCCcccccCCCcccccccCCCCCCCCCCCCCCCCCCCCCCCCCccccC
Q 042326          106 SHPLVPALFVIGDSSVDSGTNNFLGTFARADRLPYGRDFDTHQPTGRFSNGRIPVDYL  163 (163)
Q Consensus       106 ~~~~fpAIFvFGDSLSDTGNn~~l~t~~~a~~pPYGitffg~~PTGRFSDGRliiDFI  163 (163)
                      ....+++||+||||++||||+++..+.  ..+||||++|     +|||||||+|+|||
T Consensus       138 ~~~~~~ai~vFGDSlsDtGnn~y~~t~--~~~PPyG~~f-----tGRFSNG~v~~DfL  188 (408)
T PRK15381        138 SLGDITRLVFFGDSLSDSLGRMFEKTH--HILPSYGQYF-----GGRFTNGFTWTEFL  188 (408)
T ss_pred             ccCCCCeEEEeCCccccCCCccccccc--cCCCCCCCCC-----CcccCCCchhhhee
Confidence            446799999999999999998876543  5689999998     89999999999996


No 3  
>COG3240 Phospholipase/lecithinase/hemolysin [Lipid metabolism / General function prediction only]
Probab=94.85  E-value=0.036  Score=50.52  Aligned_cols=24  Identities=38%  Similarity=0.310  Sum_probs=20.1

Q ss_pred             CCCCcCEEEEcCCcccccCCCccc
Q 042326          106 SHPLVPALFVIGDSSVDSGTNNFL  129 (163)
Q Consensus       106 ~~~~fpAIFvFGDSLSDTGNn~~l  129 (163)
                      ..+.+..|.+||||++|+|+....
T Consensus        25 ~~~~~~~l~vfGDSlSDsg~~~~~   48 (370)
T COG3240          25 SLAPFQRLVVFGDSLSDSGNYYRP   48 (370)
T ss_pred             cccccceEEEeccchhhcccccCc
Confidence            345689999999999999997653


No 4  
>PF04834 Adeno_E3_14_5:  Early E3 14.5 kDa protein;  InterPro: IPR008131 The E3B 14.5 kDa was first identified in human adenovirus type 5. It is an integral membrane protein oriented with its C terminus in the cytoplasm. It functions to down-regulate the epidermal growth factor receptor and prevent tumour necrosis factor cytolysis. It achieves this through the interaction with E3 10.4 kDa protein [, ]. ; GO: 0009966 regulation of signal transduction, 0016021 integral to membrane
Probab=36.21  E-value=1.1e+02  Score=23.54  Aligned_cols=29  Identities=28%  Similarity=0.305  Sum_probs=16.5

Q ss_pred             hHHHHHHHHHHH-Hhhc------------cCCccccCCcccc
Q 042326           37 TLLVAVAKALTL-SAIF------------NPSRALEFPEDFF   65 (163)
Q Consensus        37 ~~~~~~~~~~~~-s~~f------------~~~~~~~~~~~~~   65 (163)
                      ..|++++.++++ ||+|            +...+..+|++..
T Consensus        23 ~Wl~~i~~~~v~~~t~~~l~iYp~f~~gWn~~~~~d~P~~P~   64 (97)
T PF04834_consen   23 YWLYAIGIVLVFCSTFFSLAIYPCFDFGWNHPFAFDLPVYPS   64 (97)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhheeeccccCcccccCCCCCC
Confidence            556666555543 4443            4555666777765


No 5  
>PF08282 Hydrolase_3:  haloacid dehalogenase-like hydrolase;  InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []. This HAD domain is found in several distinct enzymes including:  Phospholipid-transporting ATPase 1 (3.6.3.1 from EC), a putative lipid-flipping enzyme involved in cold tolerance in Arabidopsis [] 3-deoxy-D-manno-octulosonate (KDO) 8-phosphate phosphatase (3.1.3.45 from EC), which catalyses the final step in the biosynthesis of KDO - a component of lipopolysaccharide in Gram-negative bacteria [] Mannosyl-3-phosphoglycerate phosphatase (3.1.3.70 from EC), which hydrolyzes mannosyl-3-phosphoglycerate to form the osmolyte mannosylglycerate [] Phosphoglycolate phopshatase (3.1.3.18 from EC), which catalyses the dephosphorylation of 2-phosphoglycolate []  ; PDB: 2B30_B 3R4C_A 1XVI_B 3IJ5_B 3MMZ_C 3L7Y_A 1XPJ_C 1RLT_B 1RLM_B 2HF2_A ....
Probab=34.39  E-value=19  Score=27.17  Aligned_cols=16  Identities=25%  Similarity=0.320  Sum_probs=13.0

Q ss_pred             cCEEEEcCCcccccCC
Q 042326          110 VPALFVIGDSSVDSGT  125 (163)
Q Consensus       110 fpAIFvFGDSLSDTGN  125 (163)
                      ...+++||||.+|..-
T Consensus       202 ~~~~~~~GD~~ND~~M  217 (254)
T PF08282_consen  202 PEDIIAFGDSENDIEM  217 (254)
T ss_dssp             GGGEEEEESSGGGHHH
T ss_pred             cceeEEeecccccHhH
Confidence            4679999999999643


No 6  
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only]
Probab=27.39  E-value=31  Score=27.74  Aligned_cols=18  Identities=22%  Similarity=0.324  Sum_probs=14.5

Q ss_pred             cCEEEEcCCcccccCCCc
Q 042326          110 VPALFVIGDSSVDSGTNN  127 (163)
Q Consensus       110 fpAIFvFGDSLSDTGNn~  127 (163)
                      ...+++||||.+|.....
T Consensus       205 ~~~v~afGD~~ND~~Ml~  222 (264)
T COG0561         205 LEEVIAFGDSTNDIEMLE  222 (264)
T ss_pred             HHHeEEeCCccccHHHHH
Confidence            347999999999976654


No 7  
>PRK10976 putative hydrolase; Provisional
Probab=24.77  E-value=36  Score=27.31  Aligned_cols=17  Identities=18%  Similarity=0.218  Sum_probs=13.8

Q ss_pred             cCEEEEcCCcccccCCC
Q 042326          110 VPALFVIGDSSVDSGTN  126 (163)
Q Consensus       110 fpAIFvFGDSLSDTGNn  126 (163)
                      ...+++||||.+|..-.
T Consensus       206 ~~~viafGD~~NDi~Ml  222 (266)
T PRK10976        206 LKDCIAFGDGMNDAEML  222 (266)
T ss_pred             HHHeEEEcCCcccHHHH
Confidence            46799999999996553


No 8  
>PRK10513 sugar phosphate phosphatase; Provisional
Probab=24.74  E-value=35  Score=27.37  Aligned_cols=17  Identities=24%  Similarity=0.290  Sum_probs=13.5

Q ss_pred             cCEEEEcCCcccccCCC
Q 042326          110 VPALFVIGDSSVDSGTN  126 (163)
Q Consensus       110 fpAIFvFGDSLSDTGNn  126 (163)
                      ...+++||||.+|..-.
T Consensus       212 ~~~v~afGD~~NDi~Ml  228 (270)
T PRK10513        212 PEEVMAIGDQENDIAMI  228 (270)
T ss_pred             HHHEEEECCchhhHHHH
Confidence            45799999999996443


No 9  
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family. This small group of proteins is a member of the IIB subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. Several members of this family from thermophiles (and from Dehalococcoides ethenogenes) are now known to act as mannosyl-3-phosphoglycerate (MPG) phosphatase. In these cases, the enzyme acts after MPG synthase to make the compatible solute mannosylglycerate. We propose that other mesophilic members of this family do not act as mannosyl-3-phosphoglycerate phosphatase. A member of this family is found in Escherichia coli, which appears to lack MPG synthase. Mannosylglycerate is imported in E. coli by phosphoenolpyruvate-dependent transporter (PubMed:14645248), but it appears the phosphorylation is not on the glycerate moiety, that the phosphorylated import is degraded by an alpha-mannosidase from an adjacent gene, and that E. coli would have no pathway to obta
Probab=24.27  E-value=42  Score=27.08  Aligned_cols=18  Identities=22%  Similarity=0.147  Sum_probs=14.8

Q ss_pred             cCEEEEcCCcccccCCCc
Q 042326          110 VPALFVIGDSSVDSGTNN  127 (163)
Q Consensus       110 fpAIFvFGDSLSDTGNn~  127 (163)
                      ...++.||||.+|..-..
T Consensus       194 ~~~~~a~GD~~ND~~Ml~  211 (256)
T TIGR01486       194 AIKVVGLGDSPNDLPLLE  211 (256)
T ss_pred             CceEEEEcCCHhhHHHHH
Confidence            567999999999976544


No 10 
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed
Probab=23.87  E-value=43  Score=27.43  Aligned_cols=17  Identities=24%  Similarity=0.352  Sum_probs=13.9

Q ss_pred             CcCEEEEcCCcccccCC
Q 042326          109 LVPALFVIGDSSVDSGT  125 (163)
Q Consensus       109 ~fpAIFvFGDSLSDTGN  125 (163)
                      ....++.||||.+|..-
T Consensus       205 ~~~~viafGDs~NDi~M  221 (271)
T PRK03669        205 TRPTTLGLGDGPNDAPL  221 (271)
T ss_pred             CCceEEEEcCCHHHHHH
Confidence            45789999999999644


No 11 
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein. This family consists of members of the HAD superfamily, subfamily IIB. All members are closely related to mannosyl-3-phosphoglycerate phosphatase, the second enzyme in a two-step pathway for biosynthesis of mannosylglycerate, a compatible solute present in some thermophiles and in Dehalococcoides ethenogenes. However, members of this family are separable in a neighbor-joining tree constructed from a multiple sequence alignment and are found only in mesophiles that lack the companion mannosyl-3-phosphoglycerate synthase (TIGR02460). Members of this family are like to act on a compound related to yet distinct from mannosyl-3-phosphoglycerate.
Probab=23.80  E-value=40  Score=26.27  Aligned_cols=17  Identities=18%  Similarity=0.049  Sum_probs=13.7

Q ss_pred             CcCEEEEcCCcccccCC
Q 042326          109 LVPALFVIGDSSVDSGT  125 (163)
Q Consensus       109 ~fpAIFvFGDSLSDTGN  125 (163)
                      ....++.||||.+|..-
T Consensus       194 ~~~~vi~~GD~~NDi~m  210 (221)
T TIGR02463       194 PDVKTLGLGDGPNDLPL  210 (221)
T ss_pred             CCCcEEEECCCHHHHHH
Confidence            35679999999999654


No 12 
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal. TIGR01482, in turn, is a member of the IIB subfamily (TIGR01484) of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases.
Probab=23.15  E-value=37  Score=26.52  Aligned_cols=15  Identities=33%  Similarity=0.364  Sum_probs=12.3

Q ss_pred             CEEEEcCCcccccCC
Q 042326          111 PALFVIGDSSVDSGT  125 (163)
Q Consensus       111 pAIFvFGDSLSDTGN  125 (163)
                      ..+++||||.+|..-
T Consensus       164 ~~~i~iGDs~ND~~m  178 (215)
T TIGR01487       164 EEVAAIGDSENDIDL  178 (215)
T ss_pred             HHEEEECCCHHHHHH
Confidence            459999999999654


No 13 
>PF12710 HAD:  haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B.
Probab=22.17  E-value=54  Score=24.31  Aligned_cols=15  Identities=33%  Similarity=0.266  Sum_probs=12.2

Q ss_pred             CcCEEEEcCCccccc
Q 042326          109 LVPALFVIGDSSVDS  123 (163)
Q Consensus       109 ~fpAIFvFGDSLSDT  123 (163)
                      ....++.+|||.+|.
T Consensus       174 ~~~~~~~iGDs~~D~  188 (192)
T PF12710_consen  174 DPDRVIAIGDSINDL  188 (192)
T ss_dssp             TCCEEEEEESSGGGH
T ss_pred             CCCeEEEEECCHHHH
Confidence            356788999999995


No 14 
>PRK01158 phosphoglycolate phosphatase; Provisional
Probab=22.17  E-value=42  Score=26.08  Aligned_cols=16  Identities=31%  Similarity=0.293  Sum_probs=13.0

Q ss_pred             cCEEEEcCCcccccCC
Q 042326          110 VPALFVIGDSSVDSGT  125 (163)
Q Consensus       110 fpAIFvFGDSLSDTGN  125 (163)
                      ...++.||||.+|..-
T Consensus       173 ~~~~i~~GD~~NDi~m  188 (230)
T PRK01158        173 PEEVAAIGDSENDLEM  188 (230)
T ss_pred             HHHEEEECCchhhHHH
Confidence            4568999999999544


No 15 
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional
Probab=20.94  E-value=61  Score=25.20  Aligned_cols=15  Identities=27%  Similarity=0.410  Sum_probs=12.5

Q ss_pred             cCEEEEcCCcccccC
Q 042326          110 VPALFVIGDSSVDSG  124 (163)
Q Consensus       110 fpAIFvFGDSLSDTG  124 (163)
                      ...|..||||++.-.
T Consensus        10 ~~~iv~~GDSit~G~   24 (191)
T PRK10528         10 ADTLLILGDSLSAGY   24 (191)
T ss_pred             CCEEEEEeCchhhcC
Confidence            468999999999753


No 16 
>PF15325 MRI:  Modulator of retrovirus infection
Probab=20.56  E-value=4.3e+02  Score=20.82  Aligned_cols=11  Identities=27%  Similarity=0.353  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHH
Q 042326           38 LLVAVAKALTL   48 (163)
Q Consensus        38 ~~~~~~~~~~~   48 (163)
                      -+|-||+.+||
T Consensus         9 E~VDVALGILI   19 (106)
T PF15325_consen    9 EMVDVALGILI   19 (106)
T ss_pred             HHHHHHHHHhh
Confidence            46888888887


No 17 
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional
Probab=20.28  E-value=45  Score=27.03  Aligned_cols=17  Identities=18%  Similarity=0.253  Sum_probs=13.4

Q ss_pred             CcCEEEEcCCcccccCC
Q 042326          109 LVPALFVIGDSSVDSGT  125 (163)
Q Consensus       109 ~fpAIFvFGDSLSDTGN  125 (163)
                      ....+++|||+.+|..-
T Consensus       203 ~~~~v~afGD~~NDi~M  219 (272)
T PRK15126        203 SLADCMAFGDAMNDREM  219 (272)
T ss_pred             CHHHeEEecCCHHHHHH
Confidence            34679999999999544


Done!