Citrus Sinensis ID: 042342

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
PFAGPSHAKGIVLEKIGIEAKQPNFAIRKCSRVQLIKNGKKIVTFVPSDGCLNYIEENDKVLIAGFGRKGHAVATSPPIISLKGCMR
cccccccccEEEEEEEEEECcccccccccEEEEEEEccccEEEEEEcccccccccccccEEEEEEcccccccccccccEEEcccccc
*****SHAKGIVLEKIGIEAKQPNFAIRKCSRVQLIKNGKKIVTFVPSDGCLNYIEENDKVLIAGFGRKGHAVATSPPIISLKGCMR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PFAGPSHAKGIVLEKIGIEAKQPNFAIRKCSRVQLIKNGKKIVTFVPSDGCLNYIEENDKVLIAGFGRKGHAVATSPPIISLKGCMR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S23 probableQ6SA96
40S ribosomal protein S23-1 probableQ9SF35
40S ribosomal protein S23 probableQ3T199

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XZM, chain L
Confidence level:very confident
Coverage over the Query: 1-81
View the alignment between query and template
View the model in PyMOL