BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 042358
(193 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BBN|I Chain I, Homology Model For The Spinach Chloroplast 30s Subunit
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
Length = 197
Score = 205 bits (521), Expect = 1e-53, Method: Compositional matrix adjust.
Identities = 95/107 (88%), Positives = 101/107 (94%)
Query: 80 DLKKYVKSRLPGGFAAQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQ 139
DL+K+VKSRLPGGFAAQT+ GTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQ
Sbjct: 54 DLEKFVKSRLPGGFAAQTVIGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQ 113
Query: 140 YIKVPLVTLGYETSYDVFVKAHGGGLSGQAQAITLGVARALLKFCTS 186
Y+K PL TLGYET+YDVFVKAHGGGLSGQAQAI+LGVARALLK S
Sbjct: 114 YVKTPLATLGYETNYDVFVKAHGGGLSGQAQAISLGVARALLKVSAS 160
>pdb|1FJG|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With The Antibiotics Streptomycin,
Spectinomycin, And Paromomycin
pdb|1HR0|I Chain I, Crystal Structure Of Initiation Factor If1 Bound To The
30s Ribosomal Subunit
pdb|1HNW|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With Tetracycline
pdb|1HNX|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With Pactamycin
pdb|1HNZ|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With Hygromycin B
pdb|1GIX|L Chain L, Crystal Structure Of The Ribosome At 5.5 A Resolution.
This File, 1gix, Contains The 30s Ribosome Subunit,
Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is
In The File 1giy
pdb|1IBK|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With The Antibiotic Paromomycin
pdb|1IBL|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With A Messenger Rna Fragment And
Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
Site And With The Antibiotic Paromomycin
pdb|1IBM|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In Complex With A Messenger Rna Fragment And
Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
Site
pdb|1I94|I Chain I, Crystal Structures Of The Small Ribosomal Subunit With
Tetracycline, Edeine And If3
pdb|1I95|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From
Thermus Thermophilus In Complex With Edeine
pdb|1I96|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From
Thermus Thermophilus In Complex With The Translation
Initiation Factor If3 (C-Terminal Domain)
pdb|1I97|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From
Thermus Thermophilus In Complex With Tetracycline
pdb|1JGO|L Chain L, The Path Of Messenger Rna Through The Ribosome. This File,
1jgo, Contains The 30s Ribosome Subunit, Three Trna, And
Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
pdb|1JGP|L Chain L, The Path Of Messenger Rna Through The Ribosome. This File,
1jgp, Contains The 30s Ribosome Subunit, Three Trna, And
Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
pdb|1JGQ|L Chain L, The Path Of Messenger Rna Through The Ribosome. This File,
1jgq, Contains The 30s Ribosome Subunit, Three Trna, And
Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
pdb|1J5E|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit
pdb|1N32|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Bound To Codon And Near-Cognate Transfer Rna
Anticodon Stem-Loop Mismatched At The First Codon
Position At The A Site With Paromomycin
pdb|1N33|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Bound To Codon And Near-Cognate Transfer Rna
Anticodon Stem-Loop Mismatched At The Second Codon
Position At The A Site With Paromomycin
pdb|1N34|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In The Presence Of Codon And
Crystallographically Disordered Near-Cognate Transfer
Rna Anticodon Stem-Loop Mismatched At The First Codon
Position
pdb|1N36|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit In The Presence Of Crystallographically
Disordered Codon And Near-cognate Transfer Rna Anticodon
Stem-loop Mismatched At The Second Codon Position
pdb|1ML5|L Chain L, Structure Of The E. Coli Ribosomal Termination Complex
With Release Factor 2
pdb|1XMO|I Chain I, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed
With Aag-Mrna In The Decoding Center
pdb|1XMQ|I Chain I, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The
Decoding Center
pdb|1XNQ|I Chain I, Structure Of An Inosine-Adenine Wobble Base Pair Complex
In The Context Of The Decoding Center
pdb|1XNR|I Chain I, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair
In The Context Of The Decoding Center
pdb|1YL4|L Chain L, Crystal Structure Of 70s Ribosome With Thrs Operator And
Trnas. 30s Subunit. The Coordinates For The 50s Subunit
Are In The Pdb Entry 1yl3
pdb|2B64|I Chain I, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf1
From A Crystal Structure Of The Whole Ribosomal Complex.
This File Contains The 30s Subunit, Trnas, Mrna And
Release Factor Rf1 From A Crystal Structure Of The Whole
Ribosomal Complex". The Entire Crystal Structure
Contains One 70s Ribosome, Trnas, Mrna And Release
Factor Rf1 And Is Described In Remark 400.
pdb|2B9M|I Chain I, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2
From A Crystal Structure Of The Whole Ribosomal Complex.
This File Contains The 30s Ribosomal Subunit, Trnas,
Mrna And Release Factor Rf2 From A Crystal Structure Of
The Whole Ribosomal Complex". The Entire Crystal
Structure Contains One 70s Ribosome, Trnas, Mrna And
Release Factor Rf2 And Is Described In Remark 400.
pdb|2B9O|I Chain I, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal
Structure Of The Whole Ribosomal Complex With A Stop
Codon In The A-Site. This File Contains The 30s Subunit,
Trnas And Mrna From A Crystal Structure Of The Whole
Ribosomal Complex With A Stop Codon In The A-Site And Is
Described In Remark 400.
pdb|2F4V|I Chain I, 30s Ribosome + Designer Antibiotic
pdb|2HHH|I Chain I, Crystal Structure Of Kasugamycin Bound To The 30s
Ribosomal Subunit
pdb|2J00|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4).
This File Contains The 30s Subunit, Mrna, A-, P- And
E-Site Trnas And Paromomycin For Molecule I.
pdb|2J02|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4)
This File Contains The 30s Subunit, Mrna, A-, P- And
E-Site Trnas And Paromomycin For Molecule Ii.
pdb|2E5L|I Chain I, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via
The Shine- Dalgarno Interaction
pdb|2OW8|JJ Chain j, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
Functional Interactions And Rearrangements. This File,
2ow8, Contains The 30s Ribosome Subunit, Two Trna, And
Mrna Molecules. 50s Ribosome Subunit Is In The File
1vsa.
pdb|2UXC|I Chain I, Crystal Structure Of An Extended Trna Anticodon Stem Loop
In Complex With Its Cognate Mrna Ucgu In The Context Of
The Thermus Thermophilus 30s Subunit.
pdb|2UXB|I Chain I, Crystal Structure Of An Extended Trna Anticodon Stem Loop
In Complex With Its Cognate Mrna Gggu In The Context Of
The Thermus Thermophilus 30s Subunit.
pdb|2V46|I Chain I, Structure Of The Ribosome Recycling Factor Bound To The
Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
Trna-Fmet (Part 1 Of 4). This File Contains The 30s
Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
Molecule 1.
pdb|2V48|I Chain I, Structure Of The Ribosome Recycling Factor Bound To The
Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
Trna-Fmet (Part 3 Of 4). This File Contains The 30s
Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
Molecule 2.
pdb|2UXD|I Chain I, Crystal Structure Of An Extended Trna Anticodon Stem Loop
In Complex With Its Cognate Mrna Cggg In The Context Of
The Thermus Thermophilus 30s Subunit.
pdb|2QNH|JJ Chain j, Interactions And Dynamics Of The Shine-Dalgarno Helix In
The 70s Ribosome. This File, 2qnh, Contains The 30s
Ribosome Subunit, Two Trna, And Mrna Molecules. 50s
Ribosome Subunit Is In The File 1vsp.
pdb|2VQE|I Chain I, Modified Uridines With C5-methylene Substituents At The
First Position Of The Trna Anticodon Stabilize U-g
Wobble Pairing During Decoding
pdb|2VQF|I Chain I, Modified Uridines With C5-Methylene Substituents At The
First Position Of The Trna Anticodon Stabilize U-G
Wobble Pairing During Decoding
pdb|3D5A|I Chain I, Structural Basis For Translation Termination On The 70s
Ribosome. This File Contains The 30s Subunit, Release
Factor 1 (Rf1), Two Trna, And Mrna Molecules Of One 70s
Ribosome. The Entire Crystal Structure Contains Two 70s
Ribosomes As Described In Remark 400.
pdb|3D5C|I Chain I, Structural Basis For Translation Termination On The 70s
Ribosome. This File Contains The 30s Subunit, Release
Factor 1 (Rf1), Two Trna, And Mrna Molecules Of The
Second 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes As Described In Remark 400.
pdb|3F1E|I Chain I, Crystal Structure Of A Translation Termination Complex
Formed With Release Factor Rf2. This File Contains The
30s Subunit, Rf2, Two Trna, And Mrna Molecules Of One
70s Ribosome. The Entire Crystal Structure Contains Two
70s Ribosomes As Described In Remark 400.
pdb|3F1G|I Chain I, Crystal Structure Of A Translation Termination Complex
Formed With Release Factor Rf2. This File Contains The
30s Subunit, Rf2, Two Trna, And Mrna Molecules Of The
Second 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes As Described In Remark 400.
pdb|2WDG|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A-Site Trna,
Deacylated P-Site Trna, And E-Site Trna. This File
Contains The 30s Subunit A-,P-, And E-Site Trnas And
Paromomycin For Molecule I.
pdb|2WDH|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A-Site Trna,
Deacylated P-Site Trna, And E-Site Trna. This File
Contains The 30s Subunit A-,P-, And E-Site Trnas And
Paromomycin For Molecule Ii.
pdb|2WDK|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A- And P-Site
Trnas, And E-Site Trna. This File Contains The 30s
Subunit A-,P-, And E-Site Trnas And Paromomycin For
Molecule I.
pdb|2WDM|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome In
Complex With Mrna, Paromomycin, Acylated A- And P-Site
Trnas, And E-Site Trna. This File Contains The 30s
Subunit A-,P-, And E-Site Trnas And Paromomycin For
Molecule Ii.
pdb|2ZM6|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit
pdb|2WH1|I Chain I, Insights Into Translational Termination From The Structure
Of Rf2 Bound To The Ribosome
pdb|2WH3|I Chain I, Insights Into Translational Termination From The Structure
Of Rf2 Bound To The Ribosome). This File Contains The
30s Subunit.
pdb|2X9R|I Chain I, Structure Of The 70s Ribosome Bound To Release Factor 2
And A Substrate Analog Provides Insights Into Catalysis
Of Peptide Release
pdb|2X9T|I Chain I, Structure Of The 70s Ribosome Bound To Release Factor 2
And A Substrate Analog Provides Insights Into Catalysis
Of Peptide Release
pdb|2XFZ|I Chain I, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
70s Ribosome (Part 1 Of 4)
pdb|2XG1|I Chain I, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
70s Ribosome (Part 3 Of 4)
pdb|3OTO|I Chain I, Crystal Structure Of The 30s Ribosomal Subunit From A Ksga
Mutant Of Thermus Thermophilus (Hb8)
pdb|3OGE|I Chain I, Structure Of The Thermus Thermophilus Ribosome Complexed
With Chloramphenicol. This File Contains The 30s Subunit
Of One 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes.
pdb|3OGY|I Chain I, Structure Of The Thermus Thermophilus Ribosome Complexed
With Chloramphenicol. This File Contains The 30s Subunit
Of One 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes.
pdb|3OHC|I Chain I, Structure Of The Thermus Thermophilus Ribosome Complexed
With Erythromycin. This File Contains The 30s Subunit Of
One 70s Ribosome. The Entire Crystal Structure Contains
Two 70s Ribosomes.
pdb|3OHD|I Chain I, Structure Of The Thermus Thermophilus Ribosome Complexed
With Erythromycin. This File Contains The 30s Subunit Of
One 70s Ribosome. The Entire Crystal Structure Contains
Two 70s Ribosomes.
pdb|3OHY|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Azithromycin. This File Contains The 30s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OI0|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Azithromycin. This File Contains The 30s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OI2|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Telithromycin. This File Contains The 30s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3OI4|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome
Complexed With Telithromycin. This File Contains The 30s
Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|2XQD|I Chain I, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
Ribosome With A Gtp Analog
pdb|3ZVO|I Chain I, Crystal Structure Of The Hybrid State Of Ribosome In
Complex With The Guanosine Triphosphatase Release Factor
3
pdb|3T1H|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Complexed With A Human Anti-Codon Stem Loop
(Hasl) Of Transfer Rna Lysine 3 (Trnalys3) Bound To An
Mrna With An Aaa-Codon In The A-Site And Paromomycin
pdb|3T1Y|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Complexed With A Human Anti-Codon Stem Loop
(Hasl) Of Transfer Rna Lysine 3 (Trnalys3) Bound To An
Mrna With An Aag-Codon In The A-Site And Paromomycin
pdb|3UXS|I Chain I, The Structure Of Thermorubin In Complex With The 70s
Ribosome From Thermus Thermophilus. This File Contains
The 30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|3UXT|I Chain I, The Structure Of Thermorubin In Complex With The 70s
Ribosome From Thermus Thermophilus. This File Contains
The 30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes.'
pdb|4ABR|I Chain I, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin
With The 70s Ribosome
pdb|4AQY|I Chain I, Structure Of Ribosome-Apramycin Complexes
Length = 128
Score = 69.7 bits (169), Expect = 9e-13, Method: Compositional matrix adjust.
Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
Query: 96 QTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYD 155
+ +GTGRRK A+ARV L+ G GK +N +D EY QG + ++ PL + +D
Sbjct: 2 EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALE-PLRAVDALGRFD 60
Query: 156 VFVKAHGGGLSGQAQAITLGVARALLKF 183
++ GGG SGQ AI LG+ARAL+++
Sbjct: 61 AYITVRGGGKSGQIDAIKLGIARALVQY 88
>pdb|2HGI|L Chain L, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s
Ribosomal Subunit Can Be Found In Pdb Entry 2hgj.
pdb|2HGP|L Chain L, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
With Translocated And Rotated Shine-Dalgarno Duplex.
This Entry 2hgp Contains 30s Ribosomal Subunit. The 50s
Ribosomal Subunit Can Be Found In Pdb Entry 2hgq.
pdb|2HGR|L Chain L, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s
Ribosomal Subunit. The 50s Ribosomal Subunit Can Be
Found In Pdb Entry 2hgu.
pdb|2UU9|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Complexed With A Valine-asl With Cmo5u In
Position 34 Bound To An Mrna With A Gug-codon In The
A-site And Paromomycin.
pdb|2UUA|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Complexed With A Valine-Asl With Cmo5u In
Position 34 Bound To An Mrna With A Guc-Codon In The
A-Site And Paromomycin.
pdb|2UUB|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Complexed With A Valine-Asl With Cmo5u In
Position 34 Bound To An Mrna With A Guu-Codon In The
A-Site And Paromomycin.
pdb|2UUC|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal
Subunit Complexed With A Valine-asl With Cmo5u In
Position 34 Bound To An Mrna With A Gua-codon In The
A-site And Paromomycin.
pdb|3HUW|I Chain I, Structure Of Ef-P Bound To The 70s Ribosome; This File
Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P For
Molecule I.
pdb|3HUY|I Chain I, Structure Of Ef-P Bound To The 70s Ribosome; This File
Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P For
Molecule Ii.
pdb|2WRI|I Chain I, The Structure Of The Ribosome With Elongation Factor G
Trapped In The Post-Translocational State (Part 1 Of 4).
pdb|2WRK|I Chain I, The Structure Of The Ribosome With Elongation Factor G
Trapped In The Post-Translocational State (Part 3 Of 4).
pdb|2WRN|I Chain I, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
And Trna (Part 1 Of 4).
pdb|2WRQ|I Chain I, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
And Trna (Part 3 Of 4).
pdb|3KIQ|II Chain i, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Precleavage State; Part 1 Of 4)
pdb|3KIS|II Chain i, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Precleavage State; Part 3 Of 4)
pdb|3KIU|II Chain i, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Postcleavage State; Part 1 Of 4)
pdb|3KIX|II Chain i, Structure Of Rele Nuclease Bound To The 70s Ribosome
(Postcleavage State; Part 3 Of 4)
pdb|3KNH|I Chain I, The Structures Of Viomycin Bound To The 70s Ribosome. This
File Contains The 30s Subunit For Molecule I
pdb|3KNJ|I Chain I, The Structures Of Viomycin Bound To The 70s Ribosome. This
File Contains The 30s Subunit For Molecule Ii'
pdb|3KNL|I Chain I, The Structures Of Capreomycin Bound To The 70s Ribosome.
This File Contains The 30s Subunit For Molecule I
pdb|3KNN|I Chain I, The Structures Of Capreomycin Bound To The 70s Ribosome.
This File Contains The 30s Subunit For Molecule Ii
pdb|3I8G|L Chain L, Elongation Complex Of The 70s Ribosome With Three Trnas
And Entry 3i8g Contains 30s Ribosomal Subnit.The 50s
Ribosomal Can Be Found In Pdb Entry 3i8f. Molecule B In
The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
(50s).
pdb|3I8H|L Chain L, Elongation Complex Of The 70s Ribosome With Three Trnas
And Entry 3i8h Contains 30s Ribosomal Subnit. The 50s
Ribosomal Can Be Found In Pdb Entry 3i8i. Molecule A In
The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
(30s).
pdb|3I9B|L Chain L, Initiation Complex Of 70s Ribosome With Two Trnas And
Mrna. 3i9b Contains 30s Ribosomal Subunit Of Molecule B.
The 50s Subunit Can Be Found In Pdb Entry 3i9c. Molecule
A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
And 3i9e (50s)
pdb|3I9D|L Chain L, Initiation Complex Of 70s Ribosome With Two Trnas And
Mrna. 3i9d Contains 30s Ribosomal Subunit Of Molecule A.
The 50s Subunit Can Be Found In Pdb Entry 3i9e. Molecule
B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
And 3i9c (50s)
pdb|2XSY|I Chain I, Trna Tranlocation On The 70s Ribosome: The Pre-
Translocational Translocation Intermediate Ti(Pre)
pdb|2XUY|I Chain I, Trna Translocation On The 70s Ribosome: The Post-
Translocational Translocation Intermediate Ti(Post)
pdb|2Y0U|I Chain I, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
Near-Cognate Codon On The 70s Ribosome
pdb|2Y0W|I Chain I, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
Near-Cognate Codon On The 70s Ribosome
pdb|2Y0Y|I Chain I, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
A Near-Cognate Codon On The 70s Ribosome
pdb|2Y10|I Chain I, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
Cognate Codon On The 70s Ribosome.
pdb|2Y12|I Chain I, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
A Near-Cognate Codon On The 70s Ribosome
pdb|2Y14|I Chain I, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
A Cognate Codon On The 70s Ribosome.
pdb|2Y16|I Chain I, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
A Cognate Codon On The 70s Ribosome.
pdb|2Y18|I Chain I, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
Cognate Codon On The 70s Ribosome.
pdb|3TVF|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Leu Complex
pdb|3TVG|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Leu Complex
pdb|3UYD|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Leu Complex
pdb|3UYF|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Leu Complex
pdb|3UZ3|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Leu Complex With Paromomycin.
pdb|3UZ4|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Leu Complex With Paromomycin.
pdb|3UZ6|L Chain L, Structure Analysis Of Ribosomal Decoding. This Entry
Contains The 30s Ribosomal Subunit Of The First 70s
Molecule In The Asymmetric Unit For The Cognate Trna-Tyr
Complex
pdb|3UZ7|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Cognate
Trna-Tyr Complex.
pdb|3UZG|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Tyr Complex
pdb|3UZI|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Tyr Complex
pdb|3UZL|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The First
70s Molecule In The Asymmetric Unit For The Near-Cognate
Trna-Tyr Complex With Paromomycin
pdb|3UZM|L Chain L, Crystal Structure Analysis Of Ribosomal Decoding. This
Entry Contains The 30s Ribosomal Subunit Of The Second
70s Molecule In The Asymmetric Unit For The Near-cognate
Trna-tyr Complex With Paromomycin
pdb|4DH9|I Chain I, Crystal Structure Of Yaej Bound To The 70s Ribosome
pdb|4DHB|I Chain I, Crystal Structure Of Yaej Bound To The 70s Ribosome
pdb|3V22|I Chain I, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 30s Subunit With
Bound Rmf Of The 1st Ribosome In The Asu
pdb|3V24|I Chain I, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 30s Subunit With
Bound Rmf Of The 2nd Ribosome In The Asu
pdb|3V26|I Chain I, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 30s Subunit With
Bound Hpf Of The 1st Ribosome In The Asu
pdb|3V28|I Chain I, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 30s Subunit With
Bound Hpf Of The 2nd Ribosome In The Asu
pdb|3V2C|I Chain I, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 30s Subunit With
Bound Yfia Of The 1st Ribosome In The Asu
pdb|3V2E|I Chain I, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
Pdb Entry Contains Coordinates For The 30s Subunit With
Bound Yfia Of The 2nd Ribosome In The Asu
pdb|4DR1|I Chain I, Crystal Structure Of The Apo 30s Ribosomal Subunit From
Thermus Thermophilus (hb8)
pdb|4DR2|I Chain I, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
Ribosomal Subunit With Multiple Copies Of Paromomycin
Molecules Bound
pdb|4DR3|I Chain I, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
Ribosomal Subunit With Streptomycin Bound
pdb|4DR4|I Chain I, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
Ribosomal Subunit With Codon, Cognate Transfer Rna
Anticodon Stem-loop And Multiple Copies Of Paromomycin
Molecules Bound
pdb|4DR5|I Chain I, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
Ribosomal Subunit With Codon, Crystallographically
Disordered Cognate Transfer Rna Anticodon Stem-loop And
Streptomycin Bound
pdb|4DR6|I Chain I, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
Ribosomal Subunit With Codon, Near-cognate Transfer Rna
Anticodon Stem-loop Mismatched At The First Codon
Position And Streptomycin Bound
pdb|4DR7|I Chain I, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
Ribosomal Subunit With Codon, Crystallographically
Disordered Near-cognate Transfer Rna Anticodon Stem-loop
Mismatched At The Second Codon Position, And
Streptomycin Bound
pdb|4G5K|L Chain L, Crystal Structure Of The 70s Ribosome With Tetracycline.
This Entry Contains The 30s Subunit Of Molecule A.
pdb|4G5M|L Chain L, Crystal Structure Of The 70s Ribosome With Tetracycline.
This Entry Contains The 30s Subunit Of Molecule B.
pdb|4G5T|L Chain L, Crystal Structure Of The 70s Ribosome With Tigecycline.
This Entry Contains The 30s Subunit Of Molecule A.
pdb|4G5V|L Chain L, Crystal Structure Of The 70s Ribosome With Tigecycline.
This Entry Contains The 30s Subunit Of Molecule B.
pdb|4DUY|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, U13c
pdb|4DUZ|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, U13c, Bound
With Streptomycin
pdb|4DV0|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, U20g
pdb|4DV1|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, U20g, Bound
With Streptomycin
pdb|4DV2|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, C912a
pdb|4DV3|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, C912a, Bound
With Streptomycin
pdb|4DV4|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, A914g
pdb|4DV5|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, A914g, Bound
With Streptomycin
pdb|4DV6|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, A915g
pdb|4DV7|I Chain I, Crystal Structure Of The Thermus Thermophilus 30s
Ribosomal Subunit With A 16s Rrna Mutation, A915g, Bound
With Streptomycin
Length = 128
Score = 69.7 bits (169), Expect = 9e-13, Method: Compositional matrix adjust.
Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
Query: 96 QTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYD 155
+ +GTGRRK A+ARV L+ G GK +N +D EY QG + ++ PL + +D
Sbjct: 2 EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALE-PLRAVDALGHFD 60
Query: 156 VFVKAHGGGLSGQAQAITLGVARALLKF 183
++ GGG SGQ AI LG+ARAL+++
Sbjct: 61 AYITVRGGGKSGQIDAIKLGIARALVQY 88
>pdb|1PNS|I Chain I, Crystal Structure Of A Streptomycin Dependent Ribosome
From E. Coli, 30s Subunit Of 70s Ribosome. This File,
1pns, Contains The 30s Subunit, Two Trnas, And One Mrna
Molecule. The 50s Ribosomal Subunit Is In File 1pnu.
pdb|1PNX|I Chain I, Crystal Structure Of The Wild Type Ribosome From E. Coli,
30s Subunit Of 70s Ribosome. This File, 1pnx, Contains
Only Molecules Of The 30s Ribosomal Subunit. The 50s
Subunit Is In The Pdb File 1pny.
pdb|1VOQ|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOS|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOV|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOX|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOZ|I Chain I, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|2R1G|G Chain G, Coordinates Of The Thermus Thermophilus 30s Components
Neighboring Rbfa As Obtained By Fitting Into The Cryo-em
Map Of A 30s-rbfa Complex
pdb|3FIC|I Chain I, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
6.4 A Cryo-Em Map. This File Contains The 30s Subunit
And The Ligands
pdb|3MR8|I Chain I, Recognition Of The Amber Stop Codon By Release Factor Rf1.
This Entry 3mr8 Contains 30s Ribosomal Subunit. The 50s
Ribosomal Subunit Can Be Found In Pdb Entry 3ms1.
Molecule B In The Same Asymmetric Unit Is Deposited As
3mrz (50s) And 3ms0 (30s).
pdb|3MS0|I Chain I, Recognition Of The Amber Stop Codon By Release Factor Rf1.
This Entry 3ms0 Contains 30s Ribosomal Subunit. The 50s
Ribosomal Subunit Can Be Found In Pdb Entry 3mrz.
Molecule A In The Same Asymmetric Unit Is Deposited As
3mr8 (30s) And 3ms1 (50s).
pdb|3PYN|I Chain I, Crystal Structure Of A Complex Containing Domain 3 From
The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
File Contains The 30s Subunit Of The First 70s Ribosome.
pdb|3PYQ|I Chain I, Crystal Structure Of A Complex Containing Domain 3 From
The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
File Contains The 30s Subunit Of The Second 70s
Ribosome.
pdb|3PYS|I Chain I, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
Igr Ires Rna Bound To The 70s Ribosome. This File
Contains The 30s Subunit Of The First 70s Ribosome.
pdb|3PYU|I Chain I, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
Igr Ires Rna Bound To The 70s Ribosome. This File
Contains The 30s Subunit Of The Second 70s Ribosome
Length = 127
Score = 69.7 bits (169), Expect = 1e-12, Method: Compositional matrix adjust.
Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
Query: 96 QTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYD 155
+ +GTGRRK A+ARV L+ G GK +N +D EY QG + ++ PL + +D
Sbjct: 1 EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALE-PLRAVDALGRFD 59
Query: 156 VFVKAHGGGLSGQAQAITLGVARALLKF 183
++ GGG SGQ AI LG+ARAL+++
Sbjct: 60 AYITVRGGGKSGQIDAIKLGIARALVQY 87
>pdb|1VS5|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With The Antibiotic
Kasugamyin At 3.5a Resolution. This File Contains The
30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|1VS7|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With The Antibiotic
Kasugamyin At 3.5a Resolution. This File Contains The
30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|3E1A|W Chain W, Structure Of The 30s Subunit And The Trnas Of E. Coli
Ribosome In Pre- Accommodation State
pdb|3E1C|W Chain W, Structure Of The 30s Subunit And The Trnas Of E. Coli
Ribosome In Post-Accommodation State
pdb|3I1M|I Chain I, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1O|I Chain I, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1Q|I Chain I, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1S|I Chain I, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1Z|I Chain I, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I21|I Chain I, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3KC4|I Chain I, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
In Pdb Entry 3kcr
pdb|3OR9|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Cem-101. This File Contains The 30s Subunit Of The First
70s Ribosome.
pdb|3ORA|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Cem-101. This File Contains The 30s Subunit Of The
Second 70s Ribosome.
pdb|3IZV|M Chain M, Structural Insights Into Cognate Vs. Near-Cognate
Discrimination During Decoding. This Entry Contains The
Small Subunit Of A Ribosome Programmed With A
Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
Ef-Tu
pdb|3IZW|M Chain M, Structural Insights Into Cognate Vs. Near-Cognate
Discrimination During Decoding.This Entry Contains The
Small Subunit Of A Ribosome Programmed With A Cognate
Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
pdb|3SFS|I Chain I, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
State On A Rotated Conformation Of The Ribosome
pdb|3UOQ|I Chain I, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
State On A Rotated Conformation Of The Ribosome (Without
Viomycin)
pdb|4GAQ|I Chain I, Allosteric Control Of The Ribosome By Small-Molecule
Antibiotics
pdb|4GAS|I Chain I, Allosteric Control Of The Ribosome By Small-Molecule
Antibiotics
Length = 130
Score = 69.3 bits (168), Expect = 1e-12, Method: Compositional matrix adjust.
Identities = 35/95 (36%), Positives = 54/95 (56%), Gaps = 1/95 (1%)
Query: 93 FAAQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYET 152
A +GTGRRK + ARV ++ G GK +IN R ++Y G ++ PL +
Sbjct: 1 MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYF-GRETARMVVRQPLELVDMVE 59
Query: 153 SYDVFVKAHGGGLSGQAQAITLGVARALLKFCTSV 187
D+++ GGG+SGQA AI G+ RAL+++ S+
Sbjct: 60 KLDLYITVKGGGISGQAGAIRHGITRALMEYDESL 94
>pdb|1P6G|I Chain I, Real Space Refined Coordinates Of The 30s Subunit Fitted
Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
State Of E. Coli 70s Ribosome
pdb|1P87|I Chain I, Real Space Refined Coordinates Of The 30s Subunit Fitted
Into The Low Resolution Cryo-Em Map Of The
Initiation-Like State Of E. Coli 70s Ribosome
pdb|2AVY|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli At 3.5 A Resolution. This File Contains
The 30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2AW7|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli At 3.5 A Resolution. This File Contains
The 30s Subunit Of The Second 70s Ribosome. The Entire
Crystal Structure Contains Two 70s Ribosomes And Is
Described In Remark 400.
pdb|2I2P|I Chain I, Crystal Structure Of Ribosome With Messenger Rna And The
Anticodon Stem-Loop Of P-Site Trna. This File Contains
The 30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2I2U|I Chain I, Crystal Structure Of Ribosome With Messenger Rna And The
Anticodon Stem-Loop Of P-Site Trna. This File Contains
The 30s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2QOU|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin. This
File Contains The 30s Subunit Of The First 70s Ribosome,
With Spectinomycin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes.
pdb|2QOW|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin. This
File Contains The 30s Subunit Of The Second 70s
Ribosome, With Spectinomycin Bound. The Entire Crystal
Structure Contains Two 70s Ribosomes.
pdb|2QOY|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin And
Neomycin. This File Contains The 30s Subunit Of The
First 70s Ribosome, With Spectinomycin And Neomycin
Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes.
pdb|2QP0|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin And
Neomycin. This File Contains The 30s Subunit Of The
Second 70s Ribosome, With Spectinomycin And Neomycin
Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes.
pdb|2QAL|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Neomycin. This File
Contains The 30s Subunit Of The First 70s Ribosome, With
Neomycin Bound. The Entire Crystal Structure Contains
Two 70s Ribosomes And Is Described In Remark 400.
pdb|2QAN|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Neomycin. This File
Contains The 30s Subunit Of The Second 70s Ribosome,
With Neomycin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QB9|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin. This File
Contains The 30s Subunit Of The First 70s Ribosome, With
Gentamicin Bound. The Entire Crystal Structure Contains
Two 70s Ribosomes And Is Described In Remark 400.
pdb|2QBB|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin. This File
Contains The 30s Subunit Of The Second 70s Ribosome,
With Gentamicin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBD|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Ribosome Recycling
Factor (Rrf). This File Contains The 30s Subunit Of The
First 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBF|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Ribosome Recycling
Factor (Rrf). This File Contains The 30s Subunit Of The
Second 70s Ribosome. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBH|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin And Ribosome
Recycling Factor (Rrf). This File Contains The 30s
Subunit Of The First 70s Ribosome, With Gentamicin
Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes And Is Described In Remark 400.
pdb|2QBJ|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin And Ribosome
Recycling Factor (Rrf). This File Contains The 30s
Subunit Of The Second 70s Ribosome, With Gentamicin
Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes And Is Described In Remark 400.
pdb|2Z4K|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Paromomycin And
Ribosome Recycling Factor (Rrf). This File Contains The
30s Subunit Of The First 70s Ribosome, With Paromomycin
Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes And Is Described In Remark 400.
pdb|2Z4M|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Paromomycin And
Ribosome Recycling Factor (Rrf). This File Contains The
30s Subunit Of The Second 70s Ribosome, With Paromomycin
Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes And Is Described In Remark 400.
pdb|2VHO|I Chain I, Structure Of Pdf Binding Helix In Complex With The
Ribosome (Part 3 Of 4)
pdb|2VHP|I Chain I, Structure Of Pdf Binding Helix In Complex With The
Ribosome (Part 4 Of 4)
pdb|3DF1|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Hygromycin B. This File
Contains The 30s Subunit Of The First 70s Ribosome, With
Hygromycin B Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes.
pdb|3DF3|I Chain I, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Hygromycin B. This File
Contains The 30s Subunit Of The Second 70s Ribosome,
With Hygromycin B Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes.
pdb|3J00|I Chain I, Structure Of The Ribosome-Secye Complex In The Membrane
Environment
pdb|4ADV|I Chain I, Structure Of The E. Coli Methyltransferase Ksga Bound To
The E. Coli 30s Ribosomal Subunit
pdb|3J0U|L Chain L, Structural Characterization Of Mrna-Trna Translocation
Intermediates (30s Ribosome Of Class2 Of The Six
Classes)
pdb|3J0V|L Chain L, Structural Characterization Of Mrna-Trna Translocation
Intermediates (30s Ribosome Of Class 4a Of The Six
Classes)
pdb|3J0X|L Chain L, Structural Characterization Of Mrna-Trna Translocation
Intermediates (30s Ribosome Of Class 4b Of The Six
Classes)
pdb|3J0Z|L Chain L, Structural Characterization Of Mrna-Trna Translocation
Intermediates (30s Ribosome Of Class 5 Of The Six
Classes)
pdb|3J10|L Chain L, Structural Characterization Of Mrna-Trna Translocation
Intermediates (30s Ribosome Of Class 6 Of The Six
Classes)
pdb|3J13|K Chain K, Structural Characterization Of Mrna-Trna Translocation
Intermediates (30s Ribosome Of Class 3 Of The Six
Classes)
Length = 129
Score = 68.9 bits (167), Expect = 2e-12, Method: Compositional matrix adjust.
Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
Query: 94 AAQTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETS 153
A +GTGRRK + ARV ++ G GK +IN R ++Y G ++ PL +
Sbjct: 1 AENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYF-GRETARMVVRQPLELVDMVEK 59
Query: 154 YDVFVKAHGGGLSGQAQAITLGVARALLKFCTSV 187
D+++ GGG+SGQA AI G+ RAL+++ S+
Sbjct: 60 LDLYITVKGGGISGQAGAIRHGITRALMEYDESL 93
>pdb|3FIH|I Chain I, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
Consists Of The 30s Subunit, Trnas And The Ternary
Complex.
pdb|3IY8|I Chain I, Leishmania Tarentolae Mitonchondrial Ribosome Small
Subunit
pdb|2WWL|I Chain I, E.Coli 70s Ribosome Stalled During Translation Of Tnac
Leader Peptide. This File Contains The 30s, The P-Site
Trna And The Tnac Leader Peptide (Part 1 Of 2).
pdb|3OFO|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Erythromycin. This File Contains The 30s Subunit Of The
First 70s Ribosome.
pdb|3OFP|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Erythromycin. This File Contains The 30s Subunit Of The
Second 70s Ribosome.
pdb|3OFA|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Chloramphenicol. This File Contains The 30s Subunit Of
The First 70s Ribosome.
pdb|3OFB|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Chloramphenicol. This File Contains The 30s Subunit Of
The Second 70s Ribosome.
pdb|3OFX|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Clindamycin. This File Contains The 30s Subunit Of The
First 70s Ribosome.
pdb|3OFY|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Clindamycin. This File Contains The 30s Subunit Of The
Second 70s Ribosome
pdb|3OAQ|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Telithromycin. This File Contains The 30s Subunit Of The
First 70s Ribosome.
pdb|3OAR|I Chain I, Crystal Structure Of The E. Coli Ribosome Bound To
Telithromycin. This File Contains The 30s Subunit Of The
Second 70s Ribosome.
pdb|2YKR|I Chain I, 30s Ribosomal Subunit With Rsga Bound In The Presence Of
Gmppnp
pdb|4A2I|I Chain I, Cryo-Electron Microscopy Structure Of The 30s Subunit In
Complex With The Yjeq Biogenesis Factor
pdb|3J18|I Chain I, Structure Of The Bacterial Ribosome Complexed By
Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
(30s Subunit)
pdb|4GD1|I Chain I, Structures Of The Bacterial Ribosome In Classical And
Hybrid States Of Trna Binding
pdb|4GD2|I Chain I, Structures Of The Bacterial Ribosome In Classical And
Hybrid States Of Trna Binding
Length = 127
Score = 68.6 bits (166), Expect = 2e-12, Method: Compositional matrix adjust.
Identities = 34/89 (38%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
Query: 99 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFV 158
+GTGRRK + ARV ++ G GK +IN R ++Y G ++ PL + D+++
Sbjct: 4 YGTGRRKSSAARVFIKPGNGKIVINQRSLEQYF-GRETARMVVRQPLELVDMVEKLDLYI 62
Query: 159 KAHGGGLSGQAQAITLGVARALLKFCTSV 187
GGG+SGQA AI G+ RAL+++ S+
Sbjct: 63 TVKGGGISGQAGAIRHGITRALMEYDESL 91
>pdb|2GY9|I Chain I, Structure Of The 30s Subunit Of A Pre-Translocational E.
Coli Ribosome Obtained By Fitting Atomic Models For Rna
And Protein Components Into Cryo-Em Map Emd-1056
pdb|2GYB|I Chain I, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
Ribosome Complex Obtained By Fitting Atomic Models For
Rna And Protein Components Into Cryo-Em Map Emd-1143
Length = 126
Score = 68.6 bits (166), Expect = 2e-12, Method: Compositional matrix adjust.
Identities = 34/89 (38%), Positives = 53/89 (59%), Gaps = 1/89 (1%)
Query: 99 FGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDVFV 158
+GTGRRK + ARV ++ G GK +IN R ++Y G ++ PL + D+++
Sbjct: 3 YGTGRRKSSAARVFIKPGNGKIVINQRSLEQYF-GRETARMVVRQPLELVDMVEKLDLYI 61
Query: 159 KAHGGGLSGQAQAITLGVARALLKFCTSV 187
GGG+SGQA AI G+ RAL+++ S+
Sbjct: 62 TVKGGGISGQAGAIRHGITRALMEYDESL 90
>pdb|3J20|K Chain K, Promiscuous Behavior Of Proteins In Archaeal Ribosomes
Revealed By Cryo-em: Implications For Evolution Of
Eukaryotic Ribosomes (30s Ribosomal Subunit)
Length = 135
Score = 58.2 bits (139), Expect = 3e-09, Method: Compositional matrix adjust.
Identities = 37/92 (40%), Positives = 55/92 (59%), Gaps = 6/92 (6%)
Query: 96 QTIFGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQY-IKVPLVTLGYE--T 152
+ I TG+RK AIAR V++EG G+ IN + E ++ P ++ I PL+ G E
Sbjct: 2 RIIQTTGKRKTAIARAVIREGKGRVRINGKPV-EIIE--PEIARFTILEPLILAGEEIWN 58
Query: 153 SYDVFVKAHGGGLSGQAQAITLGVARALLKFC 184
S D+ VK GGG GQA+A + +ARAL+++
Sbjct: 59 SVDIDVKVEGGGFMGQAEAARMAIARALVEWT 90
>pdb|3HRD|C Chain C, Crystal Structure Of Nicotinate Dehydrogenase
pdb|3HRD|G Chain G, Crystal Structure Of Nicotinate Dehydrogenase
Length = 296
Score = 27.3 bits (59), Expect = 5.1, Method: Compositional matrix adjust.
Identities = 12/39 (30%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
Query: 118 GKFIINYRDAKEYLQGNPLWLQYIKVPLVTLGYETSYDV 156
G++ ++++ A+E L G PL ++ ++ L L ++T YD+
Sbjct: 224 GRYPLHFKQAEEMLVGAPLTMETMEATLPIL-HDTVYDM 261
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.137 0.401
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,666,985
Number of Sequences: 62578
Number of extensions: 172828
Number of successful extensions: 267
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 250
Number of HSP's gapped (non-prelim): 10
length of query: 193
length of database: 14,973,337
effective HSP length: 93
effective length of query: 100
effective length of database: 9,153,583
effective search space: 915358300
effective search space used: 915358300
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)