Citrus Sinensis ID: 042377

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MGILTPHQLAFIFGLLGNIVSFLVFLAPVPTFLIIYKKKSSEGYHSIPYVIALSSATLLLYYGLLKSNAVLIITINSIGCVIEVIYLMLYLIYAPQKQKSFTIKLILVFNVGAFALMMVIVNFFVKGPNRVTAVGCVCAVYNVAVFSAPLSIMRRVIKTKSVEYMPFSLSFFLTLCATMWFFYGLFVKDMVIALPNVLGFLFGIAQMILYLVYKGKKGNESNQKQQECTEMKMNLTEDDKAYTKDNNQPTDLQTN
cccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccEEEEEcHHHHHHHHHHHHHHHHHHHHHHEEcccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHEEEEcccccccccccHHHHHHccccccccccccccccccccccccc
****TPHQLAFIFGLLGNIVSFLVFLAPVPTFLIIYKKKSSEGYHSIPYVIALSSATLLLYYGLLKSNAVLIITINSIGCVIEVIYLMLYLIYAPQKQKSFTIKLILVFNVGAFALMMVIVNFFVKGPNRVTAVGCVCAVYNVAVFSAPLSIMRRVIKTKSVEYMPFSLSFFLTLCATMWFFYGLFVKDMVIALPNVLGFLFGIAQMILYLVYK*****************************************
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGILTPHQLAFIFGLLGNIVSFLVFLAPVPTFLIIYKKKSSEGYHSIPYVIALSSATLLLYYGLLKSNAVLIITINSIGCVIEVIYLMLYLIYAPQKQKSFTIKLILVFNVGAFALMMVIVNFFVKGPNRVTAVGCVCAVYNVAVFSAPLSIMRRVIKTKSVEYMPFSLSFFLTLCATMWFFYGLFVKDMVIALPNVLGFLFGIAQMILYLVYKGKKGNESNQKQQECTEMKMNLTEDDKAYTKDNNQPTDLQTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bidirectional sugar transporter SWEET9 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.probableQ9ZV02
Bidirectional sugar transporter NEC1 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane (By similarity). Promotes the formation of phloem bundles in mid-veins. Probably involved in the development of stomium cells that control anther opening time. Required for pollen viability.probableQ9FPN0
Bidirectional sugar transporter SWEET14 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.probableQ2R3P9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted