BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 042384
(78 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2NND|A Chain A, The Structural Identification Of The Interaction Site
And Functional State Of Rbp For Its Membrane Receptor
pdb|2NNE|A Chain A, The Structural Identification Of The Interaction Site
And Functional State Of Rbp For Its Membrane Receptor
Length = 178
Score = 25.8 bits (55), Expect = 6.4, Method: Compositional matrix adjust.
Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)
Query: 5 EDNGRERLKRHRIDVAGRVWIPDIWGQEEMLKDWIDCS 42
EDNG RL +I V + + G+ +L +W DCS
Sbjct: 45 EDNGNFRLFLEQIHVLEKSLVLKFHGRVRLLNNW-DCS 81
>pdb|1JKM|B Chain B, Brefeldin A Esterase, A Bacterial Homologue Of Human
Hormone Sensitive Lipase
pdb|1JKM|A Chain A, Brefeldin A Esterase, A Bacterial Homologue Of Human
Hormone Sensitive Lipase
Length = 361
Score = 25.4 bits (54), Expect = 7.5, Method: Composition-based stats.
Identities = 15/50 (30%), Positives = 25/50 (50%)
Query: 11 RLKRHRIDVAGRVWIPDIWGQEEMLKDWIDCSAFDALLVPSGIMSARAAL 60
RL R +DVA RV I + G + + + W+ + + +G + RA L
Sbjct: 311 RLARAGVDVAARVNIGLVHGADVIFRHWLPAALESTVRDVAGFAADRARL 360
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.137 0.433
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,443,536
Number of Sequences: 62578
Number of extensions: 78069
Number of successful extensions: 165
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 162
Number of HSP's gapped (non-prelim): 4
length of query: 78
length of database: 14,973,337
effective HSP length: 47
effective length of query: 31
effective length of database: 12,032,171
effective search space: 372997301
effective search space used: 372997301
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)