BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042384
         (78 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2NND|A Chain A, The Structural Identification Of The Interaction Site
          And Functional State Of Rbp For Its Membrane Receptor
 pdb|2NNE|A Chain A, The Structural Identification Of The Interaction Site
          And Functional State Of Rbp For Its Membrane Receptor
          Length = 178

 Score = 25.8 bits (55), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 5  EDNGRERLKRHRIDVAGRVWIPDIWGQEEMLKDWIDCS 42
          EDNG  RL   +I V  +  +    G+  +L +W DCS
Sbjct: 45 EDNGNFRLFLEQIHVLEKSLVLKFHGRVRLLNNW-DCS 81


>pdb|1JKM|B Chain B, Brefeldin A Esterase, A Bacterial Homologue Of Human
           Hormone Sensitive Lipase
 pdb|1JKM|A Chain A, Brefeldin A Esterase, A Bacterial Homologue Of Human
           Hormone Sensitive Lipase
          Length = 361

 Score = 25.4 bits (54), Expect = 7.5,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 11  RLKRHRIDVAGRVWIPDIWGQEEMLKDWIDCSAFDALLVPSGIMSARAAL 60
           RL R  +DVA RV I  + G + + + W+  +    +   +G  + RA L
Sbjct: 311 RLARAGVDVAARVNIGLVHGADVIFRHWLPAALESTVRDVAGFAADRARL 360


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.137    0.433 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,443,536
Number of Sequences: 62578
Number of extensions: 78069
Number of successful extensions: 165
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 162
Number of HSP's gapped (non-prelim): 4
length of query: 78
length of database: 14,973,337
effective HSP length: 47
effective length of query: 31
effective length of database: 12,032,171
effective search space: 372997301
effective search space used: 372997301
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)