Query 042384
Match_columns 78
No_of_seqs 30 out of 32
Neff 2.5
Searched_HMMs 46136
Date Fri Mar 29 05:42:31 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042384.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042384hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF11455 DUF3018: Protein of 87.9 0.45 9.7E-06 30.5 2.1 21 9-29 2-28 (65)
2 PF14047 DCR: Dppa2/4 conserve 62.0 3.7 8E-05 26.7 0.7 13 20-32 24-36 (66)
3 PRK08061 rpsN 30S ribosomal pr 53.8 6.6 0.00014 24.7 0.8 24 55-78 1-24 (61)
4 PF00680 RdRP_1: RNA dependent 44.0 13 0.00027 29.2 1.2 23 39-61 246-268 (491)
5 cd01699 RNA_dep_RNAP RNA_dep_R 43.4 15 0.00033 25.7 1.5 22 39-60 101-122 (278)
6 TIGR00292 thiazole biosynthesi 33.1 22 0.00048 26.1 1.0 28 32-59 10-40 (254)
7 PF01738 DLH: Dienelactone hyd 32.9 22 0.00047 24.1 0.8 20 21-40 16-35 (218)
8 PF02381 MraZ: MraZ protein; 27.9 21 0.00045 21.2 0.1 16 18-33 11-26 (72)
9 cd02992 PDI_a_QSOX PDIa family 27.6 42 0.00091 21.3 1.5 24 36-61 90-113 (114)
10 PF12323 HTH_OrfB_IS605: Helix 27.4 23 0.0005 19.6 0.2 17 28-44 12-28 (46)
11 PF10660 MitoNEET_N: Iron-cont 25.9 23 0.00049 22.5 0.0 37 22-58 18-56 (64)
12 PLN02361 alpha-amylase 24.2 34 0.00073 27.5 0.7 18 32-49 226-248 (401)
13 PF09343 DUF2460: Conserved hy 24.1 24 0.00052 26.1 -0.1 16 34-49 74-89 (198)
14 PF10691 DUF2497: Protein of u 24.1 31 0.00067 22.1 0.4 10 33-42 45-54 (73)
15 PF12655 DUF3787: Domain of un 24.0 32 0.0007 21.3 0.4 21 21-42 30-50 (52)
16 PF02736 Myosin_N: Myosin N-te 23.0 25 0.00054 19.7 -0.2 7 22-28 3-9 (42)
17 PF02283 CobU: Cobinamide kina 22.7 76 0.0017 22.2 2.2 18 7-30 38-55 (167)
18 cd06148 Egl_like_exo DEDDy 3'- 22.4 27 0.00059 24.3 -0.1 36 26-61 143-178 (197)
19 PF12988 DUF3872: Domain of un 20.7 22 0.00047 25.8 -0.9 14 22-35 116-129 (137)
20 PF11238 DUF3039: Protein of u 20.7 38 0.00083 21.4 0.3 10 18-27 29-38 (58)
21 PF10638 Sfi1_C: Spindle body 20.6 61 0.0013 22.7 1.3 14 6-19 23-36 (108)
No 1
>PF11455 DUF3018: Protein of unknown function (DUF3018); InterPro: IPR021558 This is a bacterial family of uncharacterised proteins.
Probab=87.85 E-value=0.45 Score=30.50 Aligned_cols=21 Identities=43% Similarity=1.074 Sum_probs=17.8
Q ss_pred HHHHHHHHHHhh--c----ceecCCcc
Q 042384 9 RERLKRHRIDVA--G----RVWIPDIW 29 (78)
Q Consensus 9 RERLKRhR~Eva--G----rV~IPd~W 29 (78)
+||.++||+.+- | .+|+||+=
T Consensus 2 ~~RV~khR~~lRa~GLRPVqiWVPDtr 28 (65)
T PF11455_consen 2 RERVRKHRERLRAAGLRPVQIWVPDTR 28 (65)
T ss_pred hHHHHHHHHHHHHcCCCcceeeCCCCC
Confidence 789999999986 4 69999974
No 2
>PF14047 DCR: Dppa2/4 conserved region
Probab=61.96 E-value=3.7 Score=26.65 Aligned_cols=13 Identities=38% Similarity=0.992 Sum_probs=11.5
Q ss_pred hcceecCCccchh
Q 042384 20 AGRVWIPDIWGQE 32 (78)
Q Consensus 20 aGrV~IPd~WGqE 32 (78)
||++|+|++.|.-
T Consensus 24 aGqawVp~~~~r~ 36 (66)
T PF14047_consen 24 AGQAWVPETPGRM 36 (66)
T ss_pred cCceeccCCCCcE
Confidence 7999999999863
No 3
>PRK08061 rpsN 30S ribosomal protein S14; Reviewed
Probab=53.76 E-value=6.6 Score=24.69 Aligned_cols=24 Identities=25% Similarity=0.410 Sum_probs=20.8
Q ss_pred HHHHHHHhcccccCCCCcccccCC
Q 042384 55 SARAALAQEGRRAHSGGLRVENRC 78 (78)
Q Consensus 55 sAR~ALvae~rr~~s~~lri~~~c 78 (78)
||+.+++....+.+...-|+.|+|
T Consensus 1 m~~~~~~~k~~~~~k~~~r~~nRC 24 (61)
T PRK08061 1 MAKKSLIAKAKRKPKFKVRAYTRC 24 (61)
T ss_pred CchhHHHHHhhcCCCCCcccceee
Confidence 578888888888888889999998
No 4
>PF00680 RdRP_1: RNA dependent RNA polymerase; InterPro: IPR001205 RNA-directed RNA polymerase (RdRp) (2.7.7.48 from EC) is an essential protein encoded in the genomes of all RNA containing viruses with no DNA stage [, ]. It catalyses synthesis of the RNA strand complementary to a given RNA template, but the precise molecular mechanism remains unclear. The postulated RNA replication process is a two-step mechanism. First, the initiation step of RNA synthesis begins at or near the 3' end of the RNA template by means of a primer-independent (de novo) mechanism. The de novo initiation consists in the addition of a nucleotide tri-phosphate (NTP) to the 3'-OH of the first initiating NTP. During the following so-called elongation phase, this nucleotidyl transfer reaction is repeated with subsequent NTPs to generate the complementary RNA product []. All the RNA-directed RNA polymerases, and many DNA-directed polymerases, employ a fold whose organisation has been likened to the shape of a right hand with three subdomains termed fingers, palm and thumb []. Only the catalytic palm subdomain, composed of a four-stranded antiparallel beta-sheet with two alpha-helices, is well conserved among all of these enzymes. In RdRp, the palm subdomain comprises three well conserved motifs (A, B and C). Motif A (D-x(4,5)-D) and motif C (GDD) are spatially juxtaposed; the Asp residues of these motifs are implied in the binding of Mg2+ and/or Mn2+. The Asn residue of motif B is involved in selection of ribonucleoside triphosphates over dNTPs and thus determines whether RNA is synthesised rather than DNA []. The domain organisation [] and the 3D structure of the catalytic centre of a wide range of RdPp's, even those with a low overall sequence homology, are conserved. The catalytic centre is formed by several motifs containing a number of conserved amino acid residues. There are 4 superfamilies of viruses that cover all RNA containing viruses with no DNA stage: Viruses containing positive-strand RNA or double-strand RNA, except retroviruses and Birnaviridae: viral RNA-directed RNA polymerases including all positive-strand RNA viruses with no DNA stage, double-strand RNA viruses, and the Cystoviridae, Reoviridae, Hypoviridae, Partitiviridae, Totiviridae families. Mononegavirales (negative-strand RNA viruses with non-segmented genomes). Negative-strand RNA viruses with segmented genomes, i.e. Orthomyxoviruses (including influenza A, B, and C viruses, Thogotoviruses, and the infectious salmon anemia virus), Arenaviruses, Bunyaviruses, Hantaviruses, Nairoviruses, Phleboviruses, Tenuiviruses and Tospoviruses. Birnaviridae family of dsRNA viruses. The RNA-directed RNA polymerases in the first of the above superfamilies can be divided into the following three subgroups: All positive-strand RNA eukaryotic viruses with no DNA stage. All RNA-containing bacteriophages -there are two families of RNA-containing bacteriophages: Leviviridae (positive ssRNA phages) and Cystoviridae (dsRNA phages). Reoviridae family of dsRNA viruses. This entry represents RNA-directed RNA polymerase found in many positive strand RNA eukaryotic viruses viruses. It is part of the genome polyprotein that contains other polypeptides such as coat proteins VP1 to VP4, core proteins P2A to P2C and P3A, genome-linked protein VPG and picornain 3C (3.4.22.28 from EC). Structural studies indicate that these proteins form the "right hand" structure found in all oligonucleotide polymerases, containing thumb, finger and palm domains, and also the additional bridging finger and thumb domains unique to RNA-directed RNA polymerases [, ].; GO: 0003723 RNA binding, 0003968 RNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3SFU_C 3NAH_A 3UR0_C 3UPF_C 3SFG_A 3NAI_C 3QID_B 3UQS_A 3OLB_M 3OLA_M ....
Probab=43.95 E-value=13 Score=29.20 Aligned_cols=23 Identities=39% Similarity=0.329 Sum_probs=17.7
Q ss_pred hccccchhccCcchhhHHHHHHH
Q 042384 39 IDCSAFDALLVPSGIMSARAALA 61 (78)
Q Consensus 39 iDcs~FDa~l~p~~i~sAR~ALv 61 (78)
.|||.||+.+.|.-+..|.+.|.
T Consensus 246 ~DyS~FD~s~~~~~~~~~~~il~ 268 (491)
T PF00680_consen 246 GDYSNFDSSLSPQLIDAAFDILN 268 (491)
T ss_dssp EEESSTHHHS-HHHHHHHHHHHH
T ss_pred eehhhcCCcccHHHHHHHHHHhh
Confidence 59999999999988877755553
No 5
>cd01699 RNA_dep_RNAP RNA_dep_RNAP: RNA-dependent RNA polymerase (RdRp) is an essential protein encoded in the genomes of all RNA containing viruses with no DNA stage. RdRp catalyzes synthesis of the RNA strand complementary to a given RNA template. RdRps of many viruses are products of processing of polyproteins. Some RdRps consist of one polypeptide chain, and others are complexes of several subunits. The domain organization and the 3D structure of the catalytic center of a wide range of RdRps, including those with a low overall sequence homology, are conserved. The catalytic center is formed by several motifs containing a number of conserved amino acid residues. This subfamily represents the RNA-dependent RNA polymerases from all positive-strand RNA eukaryotic viruses with no DNA stage.
Probab=43.44 E-value=15 Score=25.71 Aligned_cols=22 Identities=27% Similarity=0.433 Sum_probs=17.5
Q ss_pred hccccchhccCcchhhHHHHHH
Q 042384 39 IDCSAFDALLVPSGIMSARAAL 60 (78)
Q Consensus 39 iDcs~FDa~l~p~~i~sAR~AL 60 (78)
.|+|.||..+.+..+..+-+.+
T Consensus 101 ~D~s~FD~s~~~~~l~~~~~i~ 122 (278)
T cd01699 101 LDYSRFDSSLSPQLLEAEHSIY 122 (278)
T ss_pred eeccccCCCCCHHHHHHHHHHH
Confidence 6999999999988777765543
No 6
>TIGR00292 thiazole biosynthesis enzyme. This enzyme is involved in the biosynthesis of the thiamine precursor thiazole, and is repressed by thiamine.This family includes c-thi1, a Citrus gene induced during natural and ethylene induced fruit maturation and is highly homologous to plant and yeast thi genes involved in thiamine biosynthesis.
Probab=33.14 E-value=22 Score=26.12 Aligned_cols=28 Identities=29% Similarity=0.451 Sum_probs=21.8
Q ss_pred hhhhhhhhccccchhccCc---chhhHHHHH
Q 042384 32 EEMLKDWIDCSAFDALLVP---SGIMSARAA 59 (78)
Q Consensus 32 E~lLKDWiDcs~FDa~l~p---~~i~sAR~A 59 (78)
+...+||.|+..||...+. +|+..|..+
T Consensus 10 ~~~~~~~~~~~~~DVvIVGgGpAGL~aA~~l 40 (254)
T TIGR00292 10 ERYFEDLLDYAESDVIIVGAGPSGLTAAYYL 40 (254)
T ss_pred HHHHHHHHHhcCCCEEEECCCHHHHHHHHHH
Confidence 4567899999999999985 567777654
No 7
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway. Enzymes induced in 4-fluorobenzoate-utilizing bacteria have been classified into three groups on the basis of their specificity towards cis- and trans-dienelactone []. Some proteins contain repeated small fragments of this domain (for example rat kan-1 protein).; GO: 0016787 hydrolase activity; PDB: 1GGV_A 1ZIY_A 1ZI6_A 1ZIC_A 1ZJ5_A 1ZI8_A 1ZJ4_A 1ZI9_A 1ZIX_A 3F67_A.
Probab=32.95 E-value=22 Score=24.05 Aligned_cols=20 Identities=35% Similarity=0.519 Sum_probs=13.7
Q ss_pred cceecCCccchhhhhhhhhc
Q 042384 21 GRVWIPDIWGQEEMLKDWID 40 (78)
Q Consensus 21 GrV~IPd~WGqE~lLKDWiD 40 (78)
+=|+|||+||-..-++++.|
T Consensus 16 ~Vvv~~d~~G~~~~~~~~ad 35 (218)
T PF01738_consen 16 AVVVIHDIFGLNPNIRDLAD 35 (218)
T ss_dssp EEEEE-BTTBS-HHHHHHHH
T ss_pred EEEEEcCCCCCchHHHHHHH
Confidence 45788999998877777665
No 8
>PF02381 MraZ: MraZ protein; InterPro: IPR020603 this entry represents the 70 amino acid region found duplicated in the bacterial proteins MraZ. These proteins may be DNA-binding transcription factors, its members are probably enzymes containing a conserved DXXXR motif that probably forms part of the active site.; PDB: 1N0F_E 1N0E_F 1N0G_A.
Probab=27.93 E-value=21 Score=21.25 Aligned_cols=16 Identities=31% Similarity=0.492 Sum_probs=9.2
Q ss_pred HhhcceecCCccchhh
Q 042384 18 DVAGRVWIPDIWGQEE 33 (78)
Q Consensus 18 EvaGrV~IPd~WGqE~ 33 (78)
.-.|||.||..|=+.-
T Consensus 11 D~kGRi~iP~~~R~~l 26 (72)
T PF02381_consen 11 DDKGRISIPAKFREHL 26 (72)
T ss_dssp -TTSEEE--CHHHHHT
T ss_pred CCCCCEecCHHHHhhh
Confidence 3469999998875433
No 9
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein. QSOX oxidizes thiol groups to disulfides like PDI, however, unlike PDI, this oxidation is accompanied by the reduction of oxygen to hydrogen peroxide. QSOX is localized in high concentrations in cells with heavy secretory load and prefers peptides and proteins as substrates, not monothiols like glutathione. Inside the cell, QSOX is found in the endoplasmic reticulum and Golgi. The flow of reducing equivalents in a QSOX-catalyzed reaction goes from the dithiol substrate - dithiol of the QSOX TRX domain - dithiols of the QSOX ERV1p domain - FAD - oxygen.
Probab=27.61 E-value=42 Score=21.30 Aligned_cols=24 Identities=21% Similarity=0.082 Sum_probs=18.5
Q ss_pred hhhhccccchhccCcchhhHHHHHHH
Q 042384 36 KDWIDCSAFDALLVPSGIMSARAALA 61 (78)
Q Consensus 36 KDWiDcs~FDa~l~p~~i~sAR~ALv 61 (78)
+.=.+-+.||.++. .+-++|+||+
T Consensus 90 ~~~~~~~~~~~~~~--~~~~~~~~~~ 113 (114)
T cd02992 90 KEATDGLKQEGPER--DVNELREALI 113 (114)
T ss_pred ccCCCCCcccCCcc--CHHHHHHHhh
Confidence 55667778888877 6778899986
No 10
>PF12323 HTH_OrfB_IS605: Helix-turn-helix domain; InterPro: IPR021027 This entry represents an N-terminal helix-turn-helix domain found in a variety of putative transposases [, , ]. It is usually associated with PF01385 from PFAM and PF07282 from PFAM.
Probab=27.40 E-value=23 Score=19.63 Aligned_cols=17 Identities=35% Similarity=0.605 Sum_probs=14.0
Q ss_pred ccchhhhhhhhhccccc
Q 042384 28 IWGQEEMLKDWIDCSAF 44 (78)
Q Consensus 28 ~WGqE~lLKDWiDcs~F 44 (78)
+=.|+..|..|++|.-|
T Consensus 12 t~~Q~~~L~~~~~~~R~ 28 (46)
T PF12323_consen 12 TKEQEEKLERWFGACRF 28 (46)
T ss_pred CHHHHHHHHHHHHHHHH
Confidence 45799999999998765
No 11
>PF10660 MitoNEET_N: Iron-containing outer mitochondrial membrane protein N-terminus ; InterPro: IPR019610 The CDGSH iron sulphur domain are a group of iron-sulphur (Fe-S) clusters and a unique 39 amino acid CDGSH domain [C-X-C-X2-(S/T)-X3-P-X-C-D-G-(S/A/T)-H]. The CDGSH iron sulphur domain protein (also referred to as mitoNEET) is an integral membrane protein located in the outer mitochondrial membrane and whose function may be to transport iron into the mitochondria []. Iron in turn is essential for the function of several mitochondrial enzymes. This entry represents the N-terminal of the mitoNEET and Miner-type proteins that carry a CDGSH-type cluster-binding domain (IPR018967 from INTERPRO) that coordinate a redox-active 2Fe-2S cluster. In the outer mitochondrian membrane (OMM), the CDGSH 2Fe-2S-containing domain is oriented towards the cytoplasm and is tethered to the mitochondrial membrane by the N-terminal domain found in higher vertebrates [, , ]. The whole protein regulates oxidative capacity and may function in electron transfer, for instance in redox reactions with metabolic intermediates, cofactors and/or proteins localized at the OMM.; GO: 0051537 2 iron, 2 sulfur cluster binding, 0043231 intracellular membrane-bounded organelle; PDB: 2R13_A 3REE_A 2QD0_B.
Probab=25.89 E-value=23 Score=22.51 Aligned_cols=37 Identities=27% Similarity=0.472 Sum_probs=0.4
Q ss_pred ceecCCccchhhh--hhhhhccccchhccCcchhhHHHH
Q 042384 22 RVWIPDIWGQEEM--LKDWIDCSAFDALLVPSGIMSARA 58 (78)
Q Consensus 22 rV~IPd~WGqE~l--LKDWiDcs~FDa~l~p~~i~sAR~ 58 (78)
++-|||+.|.=-. .|||+-...|=+..+..|-++-+.
T Consensus 18 ~lPiP~s~gg~f~Ls~kdWl~Lvp~~~~va~igYlayk~ 56 (64)
T PF10660_consen 18 SLPIPDSFGGFFKLSVKDWLALVPFAAAVAGIGYLAYKP 56 (64)
T ss_dssp --------------------------------------C
T ss_pred cccccccccccccccHHHHHHHHhHHHHHHHHHHHhhee
Confidence 5789999998544 589998877776666666555443
No 12
>PLN02361 alpha-amylase
Probab=24.16 E-value=34 Score=27.51 Aligned_cols=18 Identities=33% Similarity=0.654 Sum_probs=14.2
Q ss_pred hhhhhhhhc-----cccchhccC
Q 042384 32 EEMLKDWID-----CSAFDALLV 49 (78)
Q Consensus 32 E~lLKDWiD-----cs~FDa~l~ 49 (78)
.+.|.+|+| +++||-+|.
T Consensus 226 ~~~l~~~~~~~~~~~~~fDF~l~ 248 (401)
T PLN02361 226 RQRIVNWIDGTGGLSAAFDFTTK 248 (401)
T ss_pred HHHHHHHHHhcCCcceeecHHHH
Confidence 467999998 668998664
No 13
>PF09343 DUF2460: Conserved hypothetical protein 2217 (DUF2460); InterPro: IPR011740 The entry represents a number of conserved hypothetical proteins. Their genes are often, though not always, encoded in apparent phage-derived regions of bacterial chromosomes. The Rhodobacter capsulatus sequence is apparently part of the gene transfer agent [see Fig.1, in ].
Probab=24.13 E-value=24 Score=26.09 Aligned_cols=16 Identities=19% Similarity=0.229 Sum_probs=13.2
Q ss_pred hhhhhhccccchhccC
Q 042384 34 MLKDWIDCSAFDALLV 49 (78)
Q Consensus 34 lLKDWiDcs~FDa~l~ 49 (78)
++|||.|+++.|-.+.
T Consensus 74 r~~Dp~D~~s~dq~ig 89 (198)
T PF09343_consen 74 RFRDPADYKSTDQVIG 89 (198)
T ss_pred ecCChhHhhhhcccee
Confidence 6799999999886654
No 14
>PF10691 DUF2497: Protein of unknown function (DUF2497) ; InterPro: IPR019632 Members of this family belong to the Alphaproteobacteria. The function of the family is not known.
Probab=24.12 E-value=31 Score=22.12 Aligned_cols=10 Identities=50% Similarity=1.109 Sum_probs=8.1
Q ss_pred hhhhhhhccc
Q 042384 33 EMLKDWIDCS 42 (78)
Q Consensus 33 ~lLKDWiDcs 42 (78)
..||+|.|.+
T Consensus 45 PmLkeWLD~n 54 (73)
T PF10691_consen 45 PMLKEWLDEN 54 (73)
T ss_pred HHHHHHHHhc
Confidence 4799999875
No 15
>PF12655 DUF3787: Domain of unknown function (DUF3787); InterPro: IPR024209 This family of proteins is functionally uncharacterised. Proteins in this family are approximately 60 amino acids in length and contain a conserved TAAW sequence motif that may be functionally important.
Probab=24.02 E-value=32 Score=21.31 Aligned_cols=21 Identities=29% Similarity=0.412 Sum_probs=15.0
Q ss_pred cceecCCccchhhhhhhhhccc
Q 042384 21 GRVWIPDIWGQEEMLKDWIDCS 42 (78)
Q Consensus 21 GrV~IPd~WGqE~lLKDWiDcs 42 (78)
-+|-||..-+=++ -|||||-.
T Consensus 30 s~V~iPse~~V~n-AKeWVD~n 50 (52)
T PF12655_consen 30 SNVPIPSEEEVIN-AKEWVDNN 50 (52)
T ss_pred CCCCCCCHHHHHH-HHHHhhcC
Confidence 4688998765544 59999853
No 16
>PF02736 Myosin_N: Myosin N-terminal SH3-like domain; InterPro: IPR004009 This domain has an SH3-like fold. It is found at the N terminus of many but not all myosins. The function of this domain is unknown.; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 2EC6_A 2W4H_M 1O1E_P 1O1D_D 1O18_A 1O1C_P 1O1B_D 1O1F_A 2W4A_M 2W4G_M ....
Probab=23.02 E-value=25 Score=19.69 Aligned_cols=7 Identities=57% Similarity=1.370 Sum_probs=5.2
Q ss_pred ceecCCc
Q 042384 22 RVWIPDI 28 (78)
Q Consensus 22 rV~IPd~ 28 (78)
.|||||-
T Consensus 3 ~vWvpD~ 9 (42)
T PF02736_consen 3 WVWVPDP 9 (42)
T ss_dssp EEEEEES
T ss_pred EEEEeCC
Confidence 5888874
No 17
>PF02283 CobU: Cobinamide kinase / cobinamide phosphate guanyltransferase; InterPro: IPR003203 This family is composed of a group of bifunctional cobalbumin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity. The crystal structure of the enzyme reveals the molecule to be a trimer with a propeller-like shape [].; GO: 0000166 nucleotide binding, 0043752 adenosylcobinamide kinase activity, 0051188 cofactor biosynthetic process; PDB: 1CBU_C 1C9K_B.
Probab=22.65 E-value=76 Score=22.21 Aligned_cols=18 Identities=44% Similarity=0.691 Sum_probs=13.8
Q ss_pred hHHHHHHHHHHHhhcceecCCccc
Q 042384 7 NGRERLKRHRIDVAGRVWIPDIWG 30 (78)
Q Consensus 7 sgRERLKRhR~EvaGrV~IPd~WG 30 (78)
..++|+++||.+= |+.|.
T Consensus 38 em~~RI~~H~~~R------~~~w~ 55 (167)
T PF02283_consen 38 EMRERIARHRQRR------PKGWI 55 (167)
T ss_dssp HHHHHHHHHHHHS------STCEE
T ss_pred HHHHHHHHHHHhC------CCCcE
Confidence 4589999999875 66664
No 18
>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins. The Egalitarian (Egl) protein subfamily is composed of Drosophila Egl and similar proteins. Egl is a component of an mRNA-binding complex which is required for oocyte specification. Egl contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. The motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The conservation of this subfamily throughout eukaryotes suggests that its members may be part of ancient RNA processing complexes that are likely to participate in the regulated processing of specific mRNAs. Some members of this subfamily do not have a completely conserved YX(3)D pattern at the ExoIII motif.
Probab=22.37 E-value=27 Score=24.34 Aligned_cols=36 Identities=25% Similarity=0.396 Sum_probs=25.9
Q ss_pred CCccchhhhhhhhhccccchhccCcchhhHHHHHHH
Q 042384 26 PDIWGQEEMLKDWIDCSAFDALLVPSGIMSARAALA 61 (78)
Q Consensus 26 Pd~WGqE~lLKDWiDcs~FDa~l~p~~i~sAR~ALv 61 (78)
+.+|++..|-+++++|.+.|+..-..--..-.++|.
T Consensus 143 ~s~W~~RPLt~~ql~YAa~Dv~~Ll~l~~~l~~~l~ 178 (197)
T cd06148 143 PKFWALRPLTEDMIRYAALDVLCLLPLYYAMLDALI 178 (197)
T ss_pred chhhhcCCCCHHHHHHHHHHHHhHHHHHHHHHHHhh
Confidence 468999999999999999999775443333333443
No 19
>PF12988 DUF3872: Domain of unknown function, B. Theta Gene description (DUF3872); InterPro: IPR024355 This entry represents proteins of unknown function found primarily in Bacteroides species. The Bacteroides thetaiotaomicron gene coding for this protein is located in a conjugate transposon and appears to be upregulated in the presence of host or other bacterial species compared to growth in pure culture [, ].; PDB: 2L3B_A 2L7Q_A.
Probab=20.72 E-value=22 Score=25.76 Aligned_cols=14 Identities=43% Similarity=0.783 Sum_probs=12.2
Q ss_pred ceecCCccchhhhh
Q 042384 22 RVWIPDIWGQEEML 35 (78)
Q Consensus 22 rV~IPd~WGqE~lL 35 (78)
.|||-|+|||+..|
T Consensus 116 dv~veDnfGq~~ql 129 (137)
T PF12988_consen 116 DVYVEDNFGQEQQL 129 (137)
T ss_dssp EEEEEETTTEEEEE
T ss_pred EEEEEeCCCCEEEE
Confidence 68999999999765
No 20
>PF11238 DUF3039: Protein of unknown function (DUF3039); InterPro: IPR021400 This family of proteins with unknown function appears to be restricted to Actinobacteria.
Probab=20.68 E-value=38 Score=21.44 Aligned_cols=10 Identities=40% Similarity=1.318 Sum_probs=7.9
Q ss_pred HhhcceecCC
Q 042384 18 DVAGRVWIPD 27 (78)
Q Consensus 18 EvaGrV~IPd 27 (78)
-.+|+||+|-
T Consensus 29 ALCGk~wvp~ 38 (58)
T PF11238_consen 29 ALCGKVWVPT 38 (58)
T ss_pred eeeCceeCCC
Confidence 3579999995
No 21
>PF10638 Sfi1_C: Spindle body associated protein C-terminus ; InterPro: IPR018907 This C-terminal domain of spindle-body-associated protein Sfi1 has an important role to play in the bridge-splitting during bi-polar spindle assembly, and this separation event possibly requires interaction with integral components of the nuclear envelope, such as the Mps2-Bbp1 complex []. Centrally to this domain is a region carrying centrin-binding repeats with repeating units containing tryptophan, IPR013665 from INTERPRO.
Probab=20.61 E-value=61 Score=22.74 Aligned_cols=14 Identities=43% Similarity=0.655 Sum_probs=11.5
Q ss_pred hhHHHHHHHHHHHh
Q 042384 6 DNGRERLKRHRIDV 19 (78)
Q Consensus 6 ~sgRERLKRhR~Ev 19 (78)
.-|.||.|+||.|-
T Consensus 23 IPGSE~vK~~rmea 36 (108)
T PF10638_consen 23 IPGSERVKRYRMEA 36 (108)
T ss_pred cCchHHHHHHHHHH
Confidence 45899999999874
Done!