Query         042384
Match_columns 78
No_of_seqs    30 out of 32
Neff          2.5 
Searched_HMMs 46136
Date          Fri Mar 29 05:42:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042384.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042384hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11455 DUF3018:  Protein  of   87.9    0.45 9.7E-06   30.5   2.1   21    9-29      2-28  (65)
  2 PF14047 DCR:  Dppa2/4 conserve  62.0     3.7   8E-05   26.7   0.7   13   20-32     24-36  (66)
  3 PRK08061 rpsN 30S ribosomal pr  53.8     6.6 0.00014   24.7   0.8   24   55-78      1-24  (61)
  4 PF00680 RdRP_1:  RNA dependent  44.0      13 0.00027   29.2   1.2   23   39-61    246-268 (491)
  5 cd01699 RNA_dep_RNAP RNA_dep_R  43.4      15 0.00033   25.7   1.5   22   39-60    101-122 (278)
  6 TIGR00292 thiazole biosynthesi  33.1      22 0.00048   26.1   1.0   28   32-59     10-40  (254)
  7 PF01738 DLH:  Dienelactone hyd  32.9      22 0.00047   24.1   0.8   20   21-40     16-35  (218)
  8 PF02381 MraZ:  MraZ protein;    27.9      21 0.00045   21.2   0.1   16   18-33     11-26  (72)
  9 cd02992 PDI_a_QSOX PDIa family  27.6      42 0.00091   21.3   1.5   24   36-61     90-113 (114)
 10 PF12323 HTH_OrfB_IS605:  Helix  27.4      23  0.0005   19.6   0.2   17   28-44     12-28  (46)
 11 PF10660 MitoNEET_N:  Iron-cont  25.9      23 0.00049   22.5   0.0   37   22-58     18-56  (64)
 12 PLN02361 alpha-amylase          24.2      34 0.00073   27.5   0.7   18   32-49    226-248 (401)
 13 PF09343 DUF2460:  Conserved hy  24.1      24 0.00052   26.1  -0.1   16   34-49     74-89  (198)
 14 PF10691 DUF2497:  Protein of u  24.1      31 0.00067   22.1   0.4   10   33-42     45-54  (73)
 15 PF12655 DUF3787:  Domain of un  24.0      32  0.0007   21.3   0.4   21   21-42     30-50  (52)
 16 PF02736 Myosin_N:  Myosin N-te  23.0      25 0.00054   19.7  -0.2    7   22-28      3-9   (42)
 17 PF02283 CobU:  Cobinamide kina  22.7      76  0.0017   22.2   2.2   18    7-30     38-55  (167)
 18 cd06148 Egl_like_exo DEDDy 3'-  22.4      27 0.00059   24.3  -0.1   36   26-61    143-178 (197)
 19 PF12988 DUF3872:  Domain of un  20.7      22 0.00047   25.8  -0.9   14   22-35    116-129 (137)
 20 PF11238 DUF3039:  Protein of u  20.7      38 0.00083   21.4   0.3   10   18-27     29-38  (58)
 21 PF10638 Sfi1_C:  Spindle body   20.6      61  0.0013   22.7   1.3   14    6-19     23-36  (108)

No 1  
>PF11455 DUF3018:  Protein  of unknown function (DUF3018);  InterPro: IPR021558  This is a bacterial family of uncharacterised proteins. 
Probab=87.85  E-value=0.45  Score=30.50  Aligned_cols=21  Identities=43%  Similarity=1.074  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHhh--c----ceecCCcc
Q 042384            9 RERLKRHRIDVA--G----RVWIPDIW   29 (78)
Q Consensus         9 RERLKRhR~Eva--G----rV~IPd~W   29 (78)
                      +||.++||+.+-  |    .+|+||+=
T Consensus         2 ~~RV~khR~~lRa~GLRPVqiWVPDtr   28 (65)
T PF11455_consen    2 RERVRKHRERLRAAGLRPVQIWVPDTR   28 (65)
T ss_pred             hHHHHHHHHHHHHcCCCcceeeCCCCC
Confidence            789999999986  4    69999974


No 2  
>PF14047 DCR:  Dppa2/4 conserved region
Probab=61.96  E-value=3.7  Score=26.65  Aligned_cols=13  Identities=38%  Similarity=0.992  Sum_probs=11.5

Q ss_pred             hcceecCCccchh
Q 042384           20 AGRVWIPDIWGQE   32 (78)
Q Consensus        20 aGrV~IPd~WGqE   32 (78)
                      ||++|+|++.|.-
T Consensus        24 aGqawVp~~~~r~   36 (66)
T PF14047_consen   24 AGQAWVPETPGRM   36 (66)
T ss_pred             cCceeccCCCCcE
Confidence            7999999999863


No 3  
>PRK08061 rpsN 30S ribosomal protein S14; Reviewed
Probab=53.76  E-value=6.6  Score=24.69  Aligned_cols=24  Identities=25%  Similarity=0.410  Sum_probs=20.8

Q ss_pred             HHHHHHHhcccccCCCCcccccCC
Q 042384           55 SARAALAQEGRRAHSGGLRVENRC   78 (78)
Q Consensus        55 sAR~ALvae~rr~~s~~lri~~~c   78 (78)
                      ||+.+++....+.+...-|+.|+|
T Consensus         1 m~~~~~~~k~~~~~k~~~r~~nRC   24 (61)
T PRK08061          1 MAKKSLIAKAKRKPKFKVRAYTRC   24 (61)
T ss_pred             CchhHHHHHhhcCCCCCcccceee
Confidence            578888888888888889999998


No 4  
>PF00680 RdRP_1:  RNA dependent RNA polymerase;  InterPro: IPR001205 RNA-directed RNA polymerase (RdRp) (2.7.7.48 from EC) is an essential protein encoded in the genomes of all RNA containing viruses with no DNA stage [, ]. It catalyses synthesis of the RNA strand complementary to a given RNA template, but the precise molecular mechanism remains unclear. The postulated RNA replication process is a two-step mechanism. First, the initiation step of RNA synthesis begins at or near the 3' end of the RNA template by means of a primer-independent (de novo) mechanism. The de novo initiation consists in the addition of a nucleotide tri-phosphate (NTP) to the 3'-OH of the first initiating NTP. During the following so-called elongation phase, this nucleotidyl transfer reaction is repeated with subsequent NTPs to generate the complementary RNA product [].  All the RNA-directed RNA polymerases, and many DNA-directed polymerases, employ a fold whose organisation has been likened to the shape of a right hand with three subdomains termed fingers, palm and thumb []. Only the catalytic palm subdomain, composed of a four-stranded antiparallel beta-sheet with two alpha-helices, is well conserved among all of these enzymes. In RdRp, the palm subdomain comprises three well conserved motifs (A, B and C). Motif A (D-x(4,5)-D) and motif C (GDD) are spatially juxtaposed; the Asp residues of these motifs are implied in the binding of Mg2+ and/or Mn2+. The Asn residue of motif B is involved in selection of ribonucleoside triphosphates over dNTPs and thus determines whether RNA is synthesised rather than DNA []. The domain organisation [] and the 3D structure of the catalytic centre of a wide range of RdPp's, even those with a low overall sequence homology, are conserved. The catalytic centre is formed by several motifs containing a number of conserved amino acid residues. There are 4 superfamilies of viruses that cover all RNA containing viruses with no DNA stage: Viruses containing positive-strand RNA or double-strand RNA, except retroviruses and Birnaviridae: viral RNA-directed RNA polymerases including all positive-strand RNA viruses with no DNA stage, double-strand RNA viruses, and the Cystoviridae, Reoviridae, Hypoviridae, Partitiviridae, Totiviridae families. Mononegavirales (negative-strand RNA viruses with non-segmented genomes). Negative-strand RNA viruses with segmented genomes, i.e. Orthomyxoviruses (including influenza A, B, and C viruses, Thogotoviruses, and the infectious salmon anemia virus), Arenaviruses, Bunyaviruses, Hantaviruses, Nairoviruses, Phleboviruses, Tenuiviruses and Tospoviruses. Birnaviridae family of dsRNA viruses.  The RNA-directed RNA polymerases in the first of the above superfamilies can be divided into the following three subgroups: All positive-strand RNA eukaryotic viruses with no DNA stage. All RNA-containing bacteriophages -there are two families of RNA-containing bacteriophages: Leviviridae (positive ssRNA phages) and Cystoviridae (dsRNA phages). Reoviridae family of dsRNA viruses.   This entry represents RNA-directed RNA polymerase found in many positive strand RNA eukaryotic viruses viruses. It is part of the genome polyprotein that contains other polypeptides such as coat proteins VP1 to VP4, core proteins P2A to P2C and P3A, genome-linked protein VPG and picornain 3C (3.4.22.28 from EC). Structural studies indicate that these proteins form the "right hand" structure found in all oligonucleotide polymerases, containing thumb, finger and palm domains, and also the additional bridging finger and thumb domains unique to RNA-directed RNA polymerases [, ].; GO: 0003723 RNA binding, 0003968 RNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3SFU_C 3NAH_A 3UR0_C 3UPF_C 3SFG_A 3NAI_C 3QID_B 3UQS_A 3OLB_M 3OLA_M ....
Probab=43.95  E-value=13  Score=29.20  Aligned_cols=23  Identities=39%  Similarity=0.329  Sum_probs=17.7

Q ss_pred             hccccchhccCcchhhHHHHHHH
Q 042384           39 IDCSAFDALLVPSGIMSARAALA   61 (78)
Q Consensus        39 iDcs~FDa~l~p~~i~sAR~ALv   61 (78)
                      .|||.||+.+.|.-+..|.+.|.
T Consensus       246 ~DyS~FD~s~~~~~~~~~~~il~  268 (491)
T PF00680_consen  246 GDYSNFDSSLSPQLIDAAFDILN  268 (491)
T ss_dssp             EEESSTHHHS-HHHHHHHHHHHH
T ss_pred             eehhhcCCcccHHHHHHHHHHhh
Confidence            59999999999988877755553


No 5  
>cd01699 RNA_dep_RNAP RNA_dep_RNAP: RNA-dependent RNA polymerase (RdRp) is an essential protein encoded in the genomes of all RNA containing viruses with no DNA stage. RdRp catalyzes synthesis of the RNA strand complementary to a given RNA template. RdRps of many viruses are products of processing of polyproteins. Some RdRps consist of one polypeptide chain, and others are complexes of several subunits. The domain organization and the 3D structure of the catalytic center of a wide range of RdRps, including those with a low overall sequence homology, are conserved. The catalytic center is formed by several motifs containing a number of conserved amino acid residues. This subfamily represents the RNA-dependent RNA polymerases from all positive-strand RNA eukaryotic viruses with no DNA stage.
Probab=43.44  E-value=15  Score=25.71  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=17.5

Q ss_pred             hccccchhccCcchhhHHHHHH
Q 042384           39 IDCSAFDALLVPSGIMSARAAL   60 (78)
Q Consensus        39 iDcs~FDa~l~p~~i~sAR~AL   60 (78)
                      .|+|.||..+.+..+..+-+.+
T Consensus       101 ~D~s~FD~s~~~~~l~~~~~i~  122 (278)
T cd01699         101 LDYSRFDSSLSPQLLEAEHSIY  122 (278)
T ss_pred             eeccccCCCCCHHHHHHHHHHH
Confidence            6999999999988777765543


No 6  
>TIGR00292 thiazole biosynthesis enzyme. This enzyme is involved in the biosynthesis of the thiamine precursor thiazole, and is repressed by thiamine.This family includes c-thi1, a Citrus gene induced during natural and ethylene induced fruit maturation and is highly homologous to plant and yeast thi genes involved in thiamine biosynthesis.
Probab=33.14  E-value=22  Score=26.12  Aligned_cols=28  Identities=29%  Similarity=0.451  Sum_probs=21.8

Q ss_pred             hhhhhhhhccccchhccCc---chhhHHHHH
Q 042384           32 EEMLKDWIDCSAFDALLVP---SGIMSARAA   59 (78)
Q Consensus        32 E~lLKDWiDcs~FDa~l~p---~~i~sAR~A   59 (78)
                      +...+||.|+..||...+.   +|+..|..+
T Consensus        10 ~~~~~~~~~~~~~DVvIVGgGpAGL~aA~~l   40 (254)
T TIGR00292        10 ERYFEDLLDYAESDVIIVGAGPSGLTAAYYL   40 (254)
T ss_pred             HHHHHHHHHhcCCCEEEECCCHHHHHHHHHH
Confidence            4567899999999999985   567777654


No 7  
>PF01738 DLH:  Dienelactone hydrolase family;  InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway. Enzymes induced in 4-fluorobenzoate-utilizing bacteria have been classified into three groups on the basis of their specificity towards cis- and trans-dienelactone []. Some proteins contain repeated small fragments of this domain (for example rat kan-1 protein).; GO: 0016787 hydrolase activity; PDB: 1GGV_A 1ZIY_A 1ZI6_A 1ZIC_A 1ZJ5_A 1ZI8_A 1ZJ4_A 1ZI9_A 1ZIX_A 3F67_A.
Probab=32.95  E-value=22  Score=24.05  Aligned_cols=20  Identities=35%  Similarity=0.519  Sum_probs=13.7

Q ss_pred             cceecCCccchhhhhhhhhc
Q 042384           21 GRVWIPDIWGQEEMLKDWID   40 (78)
Q Consensus        21 GrV~IPd~WGqE~lLKDWiD   40 (78)
                      +=|+|||+||-..-++++.|
T Consensus        16 ~Vvv~~d~~G~~~~~~~~ad   35 (218)
T PF01738_consen   16 AVVVIHDIFGLNPNIRDLAD   35 (218)
T ss_dssp             EEEEE-BTTBS-HHHHHHHH
T ss_pred             EEEEEcCCCCCchHHHHHHH
Confidence            45788999998877777665


No 8  
>PF02381 MraZ:  MraZ protein;  InterPro: IPR020603 this entry represents the 70 amino acid region found duplicated in the bacterial proteins MraZ. These proteins may be DNA-binding transcription factors, its members are probably enzymes containing a conserved DXXXR motif that probably forms part of the active site.; PDB: 1N0F_E 1N0E_F 1N0G_A.
Probab=27.93  E-value=21  Score=21.25  Aligned_cols=16  Identities=31%  Similarity=0.492  Sum_probs=9.2

Q ss_pred             HhhcceecCCccchhh
Q 042384           18 DVAGRVWIPDIWGQEE   33 (78)
Q Consensus        18 EvaGrV~IPd~WGqE~   33 (78)
                      .-.|||.||..|=+.-
T Consensus        11 D~kGRi~iP~~~R~~l   26 (72)
T PF02381_consen   11 DDKGRISIPAKFREHL   26 (72)
T ss_dssp             -TTSEEE--CHHHHHT
T ss_pred             CCCCCEecCHHHHhhh
Confidence            3469999998875433


No 9  
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein. QSOX oxidizes thiol groups to disulfides like PDI, however, unlike PDI, this oxidation is accompanied by the reduction of oxygen to hydrogen peroxide. QSOX is localized in high concentrations in cells with heavy secretory load and prefers peptides and proteins as substrates, not monothiols like glutathione. Inside the cell, QSOX is found in the endoplasmic reticulum and Golgi. The flow of reducing equivalents in a QSOX-catalyzed reaction goes from the dithiol substrate - dithiol of the QSOX TRX domain - dithiols of the QSOX ERV1p domain - FAD - oxygen.
Probab=27.61  E-value=42  Score=21.30  Aligned_cols=24  Identities=21%  Similarity=0.082  Sum_probs=18.5

Q ss_pred             hhhhccccchhccCcchhhHHHHHHH
Q 042384           36 KDWIDCSAFDALLVPSGIMSARAALA   61 (78)
Q Consensus        36 KDWiDcs~FDa~l~p~~i~sAR~ALv   61 (78)
                      +.=.+-+.||.++.  .+-++|+||+
T Consensus        90 ~~~~~~~~~~~~~~--~~~~~~~~~~  113 (114)
T cd02992          90 KEATDGLKQEGPER--DVNELREALI  113 (114)
T ss_pred             ccCCCCCcccCCcc--CHHHHHHHhh
Confidence            55667778888877  6778899986


No 10 
>PF12323 HTH_OrfB_IS605:  Helix-turn-helix domain;  InterPro: IPR021027  This entry represents an N-terminal helix-turn-helix domain found in a variety of putative transposases [, , ]. It is usually associated with PF01385 from PFAM and PF07282 from PFAM. 
Probab=27.40  E-value=23  Score=19.63  Aligned_cols=17  Identities=35%  Similarity=0.605  Sum_probs=14.0

Q ss_pred             ccchhhhhhhhhccccc
Q 042384           28 IWGQEEMLKDWIDCSAF   44 (78)
Q Consensus        28 ~WGqE~lLKDWiDcs~F   44 (78)
                      +=.|+..|..|++|.-|
T Consensus        12 t~~Q~~~L~~~~~~~R~   28 (46)
T PF12323_consen   12 TKEQEEKLERWFGACRF   28 (46)
T ss_pred             CHHHHHHHHHHHHHHHH
Confidence            45799999999998765


No 11 
>PF10660 MitoNEET_N:  Iron-containing outer mitochondrial membrane protein N-terminus  ;  InterPro: IPR019610 The CDGSH iron sulphur domain are a group of iron-sulphur (Fe-S) clusters and a unique 39 amino acid CDGSH domain [C-X-C-X2-(S/T)-X3-P-X-C-D-G-(S/A/T)-H].  The CDGSH iron sulphur domain protein (also referred to as mitoNEET) is an integral membrane protein located in the outer mitochondrial membrane and whose function may be to transport iron into the mitochondria []. Iron in turn is essential for the function of several mitochondrial enzymes.  This entry represents the N-terminal of the mitoNEET and Miner-type proteins that carry a CDGSH-type cluster-binding domain (IPR018967 from INTERPRO) that coordinate a redox-active 2Fe-2S cluster. In the outer mitochondrian membrane (OMM), the CDGSH 2Fe-2S-containing domain is oriented towards the cytoplasm and is tethered to the mitochondrial membrane by the N-terminal domain found in higher vertebrates [, , ]. The whole protein regulates oxidative capacity and may function in electron transfer, for instance in redox reactions with metabolic intermediates, cofactors and/or proteins localized at the OMM.; GO: 0051537 2 iron, 2 sulfur cluster binding, 0043231 intracellular membrane-bounded organelle; PDB: 2R13_A 3REE_A 2QD0_B.
Probab=25.89  E-value=23  Score=22.51  Aligned_cols=37  Identities=27%  Similarity=0.472  Sum_probs=0.4

Q ss_pred             ceecCCccchhhh--hhhhhccccchhccCcchhhHHHH
Q 042384           22 RVWIPDIWGQEEM--LKDWIDCSAFDALLVPSGIMSARA   58 (78)
Q Consensus        22 rV~IPd~WGqE~l--LKDWiDcs~FDa~l~p~~i~sAR~   58 (78)
                      ++-|||+.|.=-.  .|||+-...|=+..+..|-++-+.
T Consensus        18 ~lPiP~s~gg~f~Ls~kdWl~Lvp~~~~va~igYlayk~   56 (64)
T PF10660_consen   18 SLPIPDSFGGFFKLSVKDWLALVPFAAAVAGIGYLAYKP   56 (64)
T ss_dssp             --------------------------------------C
T ss_pred             cccccccccccccccHHHHHHHHhHHHHHHHHHHHhhee
Confidence            5789999998544  589998877776666666555443


No 12 
>PLN02361 alpha-amylase
Probab=24.16  E-value=34  Score=27.51  Aligned_cols=18  Identities=33%  Similarity=0.654  Sum_probs=14.2

Q ss_pred             hhhhhhhhc-----cccchhccC
Q 042384           32 EEMLKDWID-----CSAFDALLV   49 (78)
Q Consensus        32 E~lLKDWiD-----cs~FDa~l~   49 (78)
                      .+.|.+|+|     +++||-+|.
T Consensus       226 ~~~l~~~~~~~~~~~~~fDF~l~  248 (401)
T PLN02361        226 RQRIVNWIDGTGGLSAAFDFTTK  248 (401)
T ss_pred             HHHHHHHHHhcCCcceeecHHHH
Confidence            467999998     668998664


No 13 
>PF09343 DUF2460:  Conserved hypothetical protein 2217 (DUF2460);  InterPro: IPR011740 The entry represents a number of conserved hypothetical proteins. Their genes are often, though not always, encoded in apparent phage-derived regions of bacterial chromosomes. The Rhodobacter capsulatus sequence is apparently part of the gene transfer agent [see Fig.1, in ].
Probab=24.13  E-value=24  Score=26.09  Aligned_cols=16  Identities=19%  Similarity=0.229  Sum_probs=13.2

Q ss_pred             hhhhhhccccchhccC
Q 042384           34 MLKDWIDCSAFDALLV   49 (78)
Q Consensus        34 lLKDWiDcs~FDa~l~   49 (78)
                      ++|||.|+++.|-.+.
T Consensus        74 r~~Dp~D~~s~dq~ig   89 (198)
T PF09343_consen   74 RFRDPADYKSTDQVIG   89 (198)
T ss_pred             ecCChhHhhhhcccee
Confidence            6799999999886654


No 14 
>PF10691 DUF2497:  Protein of unknown function (DUF2497) ;  InterPro: IPR019632  Members of this family belong to the Alphaproteobacteria. The function of the family is not known. 
Probab=24.12  E-value=31  Score=22.12  Aligned_cols=10  Identities=50%  Similarity=1.109  Sum_probs=8.1

Q ss_pred             hhhhhhhccc
Q 042384           33 EMLKDWIDCS   42 (78)
Q Consensus        33 ~lLKDWiDcs   42 (78)
                      ..||+|.|.+
T Consensus        45 PmLkeWLD~n   54 (73)
T PF10691_consen   45 PMLKEWLDEN   54 (73)
T ss_pred             HHHHHHHHhc
Confidence            4799999875


No 15 
>PF12655 DUF3787:  Domain of unknown function (DUF3787);  InterPro: IPR024209 This family of proteins is functionally uncharacterised. Proteins in this family are approximately 60 amino acids in length and contain a conserved TAAW sequence motif that may be functionally important.
Probab=24.02  E-value=32  Score=21.31  Aligned_cols=21  Identities=29%  Similarity=0.412  Sum_probs=15.0

Q ss_pred             cceecCCccchhhhhhhhhccc
Q 042384           21 GRVWIPDIWGQEEMLKDWIDCS   42 (78)
Q Consensus        21 GrV~IPd~WGqE~lLKDWiDcs   42 (78)
                      -+|-||..-+=++ -|||||-.
T Consensus        30 s~V~iPse~~V~n-AKeWVD~n   50 (52)
T PF12655_consen   30 SNVPIPSEEEVIN-AKEWVDNN   50 (52)
T ss_pred             CCCCCCCHHHHHH-HHHHhhcC
Confidence            4688998765544 59999853


No 16 
>PF02736 Myosin_N:  Myosin N-terminal SH3-like domain;  InterPro: IPR004009 This domain has an SH3-like fold. It is found at the N terminus of many but not all myosins. The function of this domain is unknown.; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 2EC6_A 2W4H_M 1O1E_P 1O1D_D 1O18_A 1O1C_P 1O1B_D 1O1F_A 2W4A_M 2W4G_M ....
Probab=23.02  E-value=25  Score=19.69  Aligned_cols=7  Identities=57%  Similarity=1.370  Sum_probs=5.2

Q ss_pred             ceecCCc
Q 042384           22 RVWIPDI   28 (78)
Q Consensus        22 rV~IPd~   28 (78)
                      .|||||-
T Consensus         3 ~vWvpD~    9 (42)
T PF02736_consen    3 WVWVPDP    9 (42)
T ss_dssp             EEEEEES
T ss_pred             EEEEeCC
Confidence            5888874


No 17 
>PF02283 CobU:  Cobinamide kinase / cobinamide phosphate guanyltransferase;  InterPro: IPR003203 This family is composed of a group of bifunctional cobalbumin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity. The crystal structure of the enzyme reveals the molecule to be a trimer with a propeller-like shape [].; GO: 0000166 nucleotide binding, 0043752 adenosylcobinamide kinase activity, 0051188 cofactor biosynthetic process; PDB: 1CBU_C 1C9K_B.
Probab=22.65  E-value=76  Score=22.21  Aligned_cols=18  Identities=44%  Similarity=0.691  Sum_probs=13.8

Q ss_pred             hHHHHHHHHHHHhhcceecCCccc
Q 042384            7 NGRERLKRHRIDVAGRVWIPDIWG   30 (78)
Q Consensus         7 sgRERLKRhR~EvaGrV~IPd~WG   30 (78)
                      ..++|+++||.+=      |+.|.
T Consensus        38 em~~RI~~H~~~R------~~~w~   55 (167)
T PF02283_consen   38 EMRERIARHRQRR------PKGWI   55 (167)
T ss_dssp             HHHHHHHHHHHHS------STCEE
T ss_pred             HHHHHHHHHHHhC------CCCcE
Confidence            4589999999875      66664


No 18 
>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins. The Egalitarian (Egl) protein subfamily is composed of Drosophila Egl and similar proteins. Egl is a component of an mRNA-binding complex which is required for oocyte specification. Egl contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. The motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The conservation of this subfamily throughout eukaryotes suggests that its members may be part of ancient RNA processing complexes that are likely to participate in the regulated processing of specific mRNAs. Some members of this subfamily do not have a completely conserved YX(3)D pattern at the ExoIII motif.
Probab=22.37  E-value=27  Score=24.34  Aligned_cols=36  Identities=25%  Similarity=0.396  Sum_probs=25.9

Q ss_pred             CCccchhhhhhhhhccccchhccCcchhhHHHHHHH
Q 042384           26 PDIWGQEEMLKDWIDCSAFDALLVPSGIMSARAALA   61 (78)
Q Consensus        26 Pd~WGqE~lLKDWiDcs~FDa~l~p~~i~sAR~ALv   61 (78)
                      +.+|++..|-+++++|.+.|+..-..--..-.++|.
T Consensus       143 ~s~W~~RPLt~~ql~YAa~Dv~~Ll~l~~~l~~~l~  178 (197)
T cd06148         143 PKFWALRPLTEDMIRYAALDVLCLLPLYYAMLDALI  178 (197)
T ss_pred             chhhhcCCCCHHHHHHHHHHHHhHHHHHHHHHHHhh
Confidence            468999999999999999999775443333333443


No 19 
>PF12988 DUF3872:  Domain of unknown function, B. Theta Gene description (DUF3872);  InterPro: IPR024355 This entry represents proteins of unknown function found primarily in Bacteroides species. The Bacteroides thetaiotaomicron gene coding for this protein is located in a conjugate transposon and appears to be upregulated in the presence of host or other bacterial species compared to growth in pure culture [, ].; PDB: 2L3B_A 2L7Q_A.
Probab=20.72  E-value=22  Score=25.76  Aligned_cols=14  Identities=43%  Similarity=0.783  Sum_probs=12.2

Q ss_pred             ceecCCccchhhhh
Q 042384           22 RVWIPDIWGQEEML   35 (78)
Q Consensus        22 rV~IPd~WGqE~lL   35 (78)
                      .|||-|+|||+..|
T Consensus       116 dv~veDnfGq~~ql  129 (137)
T PF12988_consen  116 DVYVEDNFGQEQQL  129 (137)
T ss_dssp             EEEEEETTTEEEEE
T ss_pred             EEEEEeCCCCEEEE
Confidence            68999999999765


No 20 
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=20.68  E-value=38  Score=21.44  Aligned_cols=10  Identities=40%  Similarity=1.318  Sum_probs=7.9

Q ss_pred             HhhcceecCC
Q 042384           18 DVAGRVWIPD   27 (78)
Q Consensus        18 EvaGrV~IPd   27 (78)
                      -.+|+||+|-
T Consensus        29 ALCGk~wvp~   38 (58)
T PF11238_consen   29 ALCGKVWVPT   38 (58)
T ss_pred             eeeCceeCCC
Confidence            3579999995


No 21 
>PF10638 Sfi1_C:  Spindle body associated protein C-terminus  ;  InterPro: IPR018907  This C-terminal domain of spindle-body-associated protein Sfi1 has an important role to play in the bridge-splitting during bi-polar spindle assembly, and this separation event possibly requires interaction with integral components of the nuclear envelope, such as the Mps2-Bbp1 complex []. Centrally to this domain is a region carrying centrin-binding repeats with repeating units containing tryptophan, IPR013665 from INTERPRO. 
Probab=20.61  E-value=61  Score=22.74  Aligned_cols=14  Identities=43%  Similarity=0.655  Sum_probs=11.5

Q ss_pred             hhHHHHHHHHHHHh
Q 042384            6 DNGRERLKRHRIDV   19 (78)
Q Consensus         6 ~sgRERLKRhR~Ev   19 (78)
                      .-|.||.|+||.|-
T Consensus        23 IPGSE~vK~~rmea   36 (108)
T PF10638_consen   23 IPGSERVKRYRMEA   36 (108)
T ss_pred             cCchHHHHHHHHHH
Confidence            45899999999874


Done!