Citrus Sinensis ID: 042402

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520---
MVVLAASIVSKSGKILVSRQFVDMSRIRIEGLLAAFPKLVGTGKQHTYVETENVRYVYQPIEALYLLLVTNKQSNILEDLETLRLLSKLVPEYSYSLDEEGICKTAFELLFAFDEVISLGHKENVTVAQVKQYCEMESHEEKLHKLVVQSKINETKDVMKRKASEIDKSKIEKNRGDKGGFMSLQSMGSGRIESSFSDMSISSGGGGFGSGSGFGLATTDVETFSSKSKGRPPSSANAPPKGLGMQLGKSQRTNQFLESLKAEGEVILEDVKPIAGQSRAAAAAPPLTDPITLTVEEKINVSLKRDGGMSNFDVQGTLSLQILNQEDGLIQVQIETGGNPGILFKTHPNMNKELFTHENILGLKDPNRPFPQAKLWRMQSADESMVPLTINCWPSVSGNETYVSIEYEASTMFDLRNVVISVPLPALREAPSVRQIDGEWRYDSRNSVLEWTILLIDNSNRSGSMEFVVPPADSSSFFPISVRFSATSTYSDLKVVNIIPLRGGAPPKFSQRTVLITENYQVV
ccEEEEEEEcccccEEEEEccccccHHHHHHHHHHHcccccccccccEEECccEEEEEEEcccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccEEEEEHHHHHHcccccEEcHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEEEEEECcccCEEEEEEEEEEEEEEcccccEEEEEEEccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccccEEEEEECcccccCEEEEEEEEEcccccEEEEEEEEEccccccccCECcccccEEECccccEEEEEEEEEccccccCEEEEEEccccccccccEEEEEEEccCEccEEEEEEEEccccccccCEEEEEEEEEcEEEc
MVVLAASIVSKSGKILVSRQFVDMSRIRIEGLLAAFPKLVGTGKQHTYVETENVRYVYQPIEALYLLLVTNKQSNILEDLETLRLLSKLVPEYSYSLDEEGICKTAFELLFAFDEVISLGHKENVTVAQVKQYCEMESH******LV*********************************************************************************************************************************************DPITLTVEEKINVSLKRDGGMSNFDVQGTLSLQILNQEDGLIQVQIETGGNPGILFKTHPNMNKELFTHENILGLKDPNRPFPQAKLWRMQSADESMVPLTINCWPSVSGNETYVSIEYEASTMFDLRNVVISVPLPALREAPSVRQIDGEWRYDSRNSVLEWTILLIDNSNRSGSMEFVVPPADSSSFFPISVRFSATSTYSDLKVVNIIPLRGGAPPKFSQRTVLITENYQVV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVLAASIVSKSGKILVSRQFVDMSRIRIEGLLAAFPKLVGTGKQHTYVETENVRYVYQPIEALYLLLVTNKQSNILEDLETLRLLSKLVPEYSYSLDEEGICKTAFELLFAFDEVISLGHKENVTVAQVKQYCEMESHEEKLHKLVVQSKINETKDVMKRKASEIDKSKIEKNRGDKGGFMSLQSMGSGRIESSFSDMSISSGGGGFGSGSGFGLATTDVETFSSKSKGRPPSSANAPPKGLGMQLGKSQRTNQFLESLKAEGEVILEDVKPIAGQSRAAAAAPPLTDPITLTVEEKINVSLKRDGGMSNFDVQGTLSLQILNQEDGLIQVQIETGGNPGILFKTHPNMNKELFTHENILGLKDPNRPFPQAKLWRMQSADESMVPLTINCWPSVSGNETYVSIEYEASTMFDLRNVVISVPLPALREAPSVRQIDGEWRYDSRNSVLEWTILLIDNSNRSGSMEFVVPPADSSSFFPISVRFSATSTYSDLKVVNIIPLRGGAPPKFSQRTVLITENYQVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coatomer subunit delta-1 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ0DJA0
Coatomer subunit delta-2 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ0DJ99
Coatomer subunit delta The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ93Y22

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VGL, chain M
Confidence level:very confident
Coverage over the Query: 3-142,238-245,285-522
View the alignment between query and template
View the model in PyMOL