Query         042412
Match_columns 74
No_of_seqs    119 out of 1013
Neff          5.6 
Searched_HMMs 46136
Date          Fri Mar 29 05:57:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042412.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042412hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0014 MADS box transcription 100.0   1E-28 2.2E-33  167.0   5.0   60   10-71      1-61  (195)
  2 smart00432 MADS MADS domain.    99.9 3.2E-28   7E-33  142.7   5.6   58   11-70      1-59  (59)
  3 cd00265 MADS_MEF2_like MEF2 (m  99.9 2.1E-28 4.6E-33  149.2   4.5   59   11-71      1-60  (77)
  4 cd00120 MADS MADS: MCM1, Agamo  99.9 1.4E-27 3.1E-32  139.8   4.5   58   11-70      1-59  (59)
  5 cd00266 MADS_SRF_like SRF-like  99.9   1E-26 2.3E-31  143.3   5.3   59   11-71      1-60  (83)
  6 PF00319 SRF-TF:  SRF-type tran  99.9 1.4E-26   3E-31  132.5   3.6   51   17-69      1-51  (51)
  7 KOG0015 Regulator of arginine   99.8 4.4E-21 9.5E-26  141.8   4.3   68    2-71     54-122 (338)
  8 COG5068 ARG80 Regulator of arg  99.5 3.4E-14 7.4E-19  108.2   4.8   61    9-71     80-141 (412)
  9 PF09151 DUF1936:  Domain of un  56.1      18 0.00039   18.9   2.6   24   42-67      2-25  (36)
 10 PF13540 RCC1_2:  Regulator of   39.8      34 0.00073   16.6   2.0   25   44-71      3-27  (30)
 11 PF13252 DUF4043:  Protein of u  39.1      15 0.00032   27.9   0.9   31   39-69    270-300 (341)
 12 PF10491 Nrf1_DNA-bind:  NLS-bi  38.2      80  0.0017   22.9   4.4   28   35-62     36-67  (214)
 13 PRK09555 feoA ferrous iron tra  36.9      88  0.0019   18.4   3.9   33   34-68     20-52  (74)
 14 TIGR01916 F420_cofE F420-0:gam  30.2      61  0.0013   23.7   2.9   27   42-70    134-160 (243)
 15 CHL00082 psbZ photosystem II p  29.6      34 0.00073   20.2   1.2   13   62-74     22-34  (62)
 16 cd01372 KISc_KIF4 Kinesin moto  27.3      68  0.0015   23.4   2.7   27   44-70     68-94  (341)
 17 PF15119 APOC4:  Apolipoprotein  27.1      41  0.0009   21.4   1.4   20   29-48     75-96  (99)
 18 cd01365 KISc_KIF1A_KIF1B Kines  27.0      77  0.0017   23.4   3.0   35   34-68     70-107 (356)
 19 cd01363 Motor_domain Myosin an  26.7      80  0.0017   21.0   2.8   33   36-68      8-42  (186)
 20 PRK13293 F420-0--gamma-glutamy  26.4      72  0.0016   23.3   2.7   27   42-70    135-161 (245)
 21 cd00106 KISc Kinesin motor dom  26.2      83  0.0018   22.6   3.0   26   44-69     73-98  (328)
 22 PF04019 DUF359:  Protein of un  25.9      23 0.00049   23.1  -0.0   16   54-71     80-95  (121)
 23 PRK02576 psbZ photosystem II r  25.8      42 0.00092   19.8   1.2   12   62-73     22-33  (62)
 24 TIGR03043 PS_II_psbZ photosyst  25.6      43 0.00093   19.5   1.1   13   62-74     19-31  (58)
 25 cd01376 KISc_KID_like Kinesin   25.2      89  0.0019   22.7   3.0   26   44-69     75-100 (319)
 26 cd06404 PB1_aPKC PB1 domain is  25.0 1.7E+02  0.0036   18.1   3.8   38   33-71     22-59  (83)
 27 cd01366 KISc_C_terminal Kinesi  24.7 1.1E+02  0.0023   22.2   3.3   27   44-70     72-98  (329)
 28 COG1918 FeoA Fe2+ transport sy  24.4 1.7E+02  0.0036   17.5   5.1   45   10-67      8-52  (75)
 29 COG0139 HisI Phosphoribosyl-AM  24.1      24 0.00052   23.1  -0.1   31   29-59     54-93  (111)
 30 cd01371 KISc_KIF3 Kinesin moto  24.0      81  0.0018   23.1   2.6   26   44-69     76-101 (333)
 31 cd01375 KISc_KIF9_like Kinesin  23.3      78  0.0017   23.2   2.4   25   44-68     75-99  (334)
 32 cd01369 KISc_KHC_KIF5 Kinesin   23.3 1.1E+02  0.0025   22.1   3.3   27   44-70     71-97  (325)
 33 PF00383 dCMP_cyt_deam_1:  Cyti  23.0 1.7E+02  0.0037   17.1   3.6   31   35-67      6-40  (102)
 34 PRK09732 hypothetical protein;  22.8 2.2E+02  0.0048   18.7   4.3   34   36-71     15-48  (134)
 35 cd01373 KISc_KLP2_like Kinesin  21.6 1.1E+02  0.0024   22.5   2.9   27   44-70     69-95  (337)
 36 cd01374 KISc_CENP_E Kinesin mo  21.1   1E+02  0.0022   22.3   2.6   26   44-69     68-93  (321)
 37 smart00129 KISc Kinesin motor,  21.0 1.2E+02  0.0025   22.0   2.9   25   44-68     74-98  (335)
 38 cd01367 KISc_KIF2_like Kinesin  20.5 1.1E+02  0.0023   22.4   2.6   26   44-69     79-104 (322)
 39 cd01368 KISc_KIF23_like Kinesi  20.3 1.3E+02  0.0028   22.3   3.1   26   44-69     83-108 (345)

No 1  
>KOG0014 consensus MADS box transcription factor [Transcription]
Probab=99.95  E-value=1e-28  Score=167.05  Aligned_cols=60  Identities=48%  Similarity=0.837  Sum_probs=58.7

Q ss_pred             Ccc-ceeeEEecCcccchhhhhhhhhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEecCCC
Q 042412           10 MGK-KIEIKKIADAKARQVTYAKRKKSLIKKAREISVACGIDLVLITFSPTKRGRSTKFCSMK   71 (74)
Q Consensus        10 mgR-Ki~ik~I~~~~~R~~tf~KRk~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s~~   71 (74)
                      ||| ||+|++|+|+..|++||+||+.||||||+||||||||+||+|||+|+  |++|.|++++
T Consensus         1 M~R~ki~i~~Ien~~~RqvTFsKRr~GL~KKA~ELsvLCd~eiavIifsp~--~~~~~~~~~~   61 (195)
T KOG0014|consen    1 MGRGKIEIKRIENESSRQVTFSKRRNGLFKKASELSVLCDAEIAVIVFSPS--GKLYEFGSSD   61 (195)
T ss_pred             CCCCccceeeccccchhhhhhHHHHhhHHHHHHHHHHhcCCeEEEEEECCC--CCccccCCcc
Confidence            899 99999999999999999999999999999999999999999999999  9999999886


No 2  
>smart00432 MADS MADS domain.
Probab=99.95  E-value=3.2e-28  Score=142.66  Aligned_cols=58  Identities=52%  Similarity=0.854  Sum_probs=56.5

Q ss_pred             cc-ceeeEEecCcccchhhhhhhhhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEecCC
Q 042412           11 GK-KIEIKKIADAKARQVTYAKRKKSLIKKAREISVACGIDLVLITFSPTKRGRSTKFCSM   70 (74)
Q Consensus        11 gR-Ki~ik~I~~~~~R~~tf~KRk~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s~   70 (74)
                      || ||+|++|+|++.|++||+||+.||+|||+|||+||||+||+|||+|+  |.++.|.+|
T Consensus         1 gR~Ki~i~~I~~~~~R~~tf~kRk~gl~kKa~Els~Lc~~~v~~iv~sp~--g~~~~~~~p   59 (59)
T smart00432        1 GRRKIEIKRIENKTNRQVTFSKRRNGLFKKAHELSVLCDAEVALIVFSPT--GKLYEFASP   59 (59)
T ss_pred             CCCcceeEEeeCcchhhhhhHhhhhhHHHHHHHHhhccCCeEEEEEECCC--CCeeeccCC
Confidence            78 99999999999999999999999999999999999999999999999  999999886


No 3  
>cd00265 MADS_MEF2_like MEF2 (myocyte enhancer factor 2)-like/Type II subfamily of MADS ( MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptional regulators. Binds DNA and exists as hetero and homo-dimers. Differs from SRF-like/Type I subgroup mainly in position of the alpha helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals.  Also found in fungi.
Probab=99.95  E-value=2.1e-28  Score=149.19  Aligned_cols=59  Identities=47%  Similarity=0.807  Sum_probs=57.8

Q ss_pred             cc-ceeeEEecCcccchhhhhhhhhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEecCCC
Q 042412           11 GK-KIEIKKIADAKARQVTYAKRKKSLIKKAREISVACGIDLVLITFSPTKRGRSTKFCSMK   71 (74)
Q Consensus        11 gR-Ki~ik~I~~~~~R~~tf~KRk~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s~~   71 (74)
                      || ||+|++|+|++.|++||+||+.||||||.|||+|||++||+|||+|+  |++|.|++|+
T Consensus         1 gr~ki~i~~i~~~~~r~~tf~kR~~gl~kKa~Els~Lc~~~v~lvv~sp~--gk~~~f~s~s   60 (77)
T cd00265           1 GRGKIEIKRIENSTNRQVTFSKRRNGLLKKAHELSVLCDAEVALIIFSSS--GKLYEFSSPS   60 (77)
T ss_pred             CCCcceeEEecCccHHHHHHHHhhhhhhhcceeheeccCCceeEEEEcCC--CceEEecCCC
Confidence            78 99999999999999999999999999999999999999999999999  9999999987


No 4  
>cd00120 MADS MADS: MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptonal regulators. Binds DNA and exists as hetero and homo-dimers.  Composed of 2 main subgroups: SRF-like/Type I and MEF2-like (myocyte enhancer factor 2)/ Type II. These subgroups differ mainly in position of the alpha 2 helix responsible for the dimerization interface; Important in homeotic regulation in plants and in immediate-early development in animals.  Also found in fungi.
Probab=99.94  E-value=1.4e-27  Score=139.85  Aligned_cols=58  Identities=48%  Similarity=0.836  Sum_probs=56.1

Q ss_pred             cc-ceeeEEecCcccchhhhhhhhhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEecCC
Q 042412           11 GK-KIEIKKIADAKARQVTYAKRKKSLIKKAREISVACGIDLVLITFSPTKRGRSTKFCSM   70 (74)
Q Consensus        11 gR-Ki~ik~I~~~~~R~~tf~KRk~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s~   70 (74)
                      || ||+|++|+|+..|++||+||+.||+|||+|||+|||++||+|||+|+  |.+++|+++
T Consensus         1 gr~Ki~i~~I~~~~~R~~tf~kR~~gl~kKa~Els~Lc~~~v~~iv~sp~--g~~~~~~~~   59 (59)
T cd00120           1 GRGKIEIKRIENKTSRQVTFSKRRNGLFKKASELSVLCDAEVAVIVFSPS--GKLYEFWSS   59 (59)
T ss_pred             CCccceeEEeeCcchhhhhHHHHhchHHHhhhhheeccCCcEEEEEECCC--CCcccccCC
Confidence            68 99999999999999999999999999999999999999999999999  899999875


No 5  
>cd00266 MADS_SRF_like SRF-like/Type I subfamily of MADS (MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptional regulators. Binds DNA and exists as hetero- and homo-dimers. Differs from the MEF-like/Type II subgroup mainly in position of the alpha 2 helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals.  Also found in fungi.
Probab=99.93  E-value=1e-26  Score=143.31  Aligned_cols=59  Identities=42%  Similarity=0.786  Sum_probs=55.9

Q ss_pred             cc-ceeeEEecCcccchhhhhhhhhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEecCCC
Q 042412           11 GK-KIEIKKIADAKARQVTYAKRKKSLIKKAREISVACGIDLVLITFSPTKRGRSTKFCSMK   71 (74)
Q Consensus        11 gR-Ki~ik~I~~~~~R~~tf~KRk~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s~~   71 (74)
                      || ||+|++|+|+..|++||+||+.||+|||+|||+|||++||+|||+|+  |..+.|.+++
T Consensus         1 gr~Ki~i~~I~~~~~R~~tf~KRk~gl~kKa~ELs~Lc~~~v~~iv~sp~--~~~~~~~~~~   60 (83)
T cd00266           1 GRKKIKIKRIENKKKRAVTFSKRRQGLFKKASELSTLCGAEVAVIVYSPS--GKLYVFWPSS   60 (83)
T ss_pred             CCccceeEEeeccchhhhhHHHhhhhHHHHHHHHHHhhCCcEEEEEECCC--CCcceecCcH
Confidence            68 99999999999999999999999999999999999999999999999  7888887765


No 6  
>PF00319 SRF-TF:  SRF-type transcription factor (DNA-binding and dimerisation domain);  InterPro: IPR002100 Human serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation []. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic alpha-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel beta-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see IPR002487 from INTERPRO ; GO: 0003677 DNA binding, 0046983 protein dimerization activity; PDB: 1MNM_B 1N6J_A 1TQE_S 3MU6_D 3P57_I 1EGW_A 1C7U_B 3KOV_A 1HBX_A 1K6O_C ....
Probab=99.93  E-value=1.4e-26  Score=132.50  Aligned_cols=51  Identities=51%  Similarity=0.845  Sum_probs=46.9

Q ss_pred             EEecCcccchhhhhhhhhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEecC
Q 042412           17 KKIADAKARQVTYAKRKKSLIKKAREISVACGIDLVLITFSPTKRGRSTKFCS   69 (74)
Q Consensus        17 k~I~~~~~R~~tf~KRk~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s   69 (74)
                      ++|+|+..|++||+||+.||+|||+|||+|||++||+|+|+|+  |++|+|+|
T Consensus         1 K~I~n~~~R~~tf~KRk~gL~KKa~ELs~LC~~~v~~iv~~~~--g~~~~f~s   51 (51)
T PF00319_consen    1 KRIENKSRRKVTFSKRKKGLFKKASELSTLCGVDVALIVFSPD--GKLYTFPS   51 (51)
T ss_dssp             S--SSHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEEETT--SEEEEEES
T ss_pred             CCccchhHhHhHHHHHHhhhhhccceeeeecCCeEEEEEECCC--CCEEEecC
Confidence            5799999999999999999999999999999999999999999  99999997


No 7  
>KOG0015 consensus Regulator of arginine metabolism and related MADS box-containing transcription factors [Transcription]
Probab=99.83  E-value=4.4e-21  Score=141.76  Aligned_cols=68  Identities=34%  Similarity=0.468  Sum_probs=64.0

Q ss_pred             ccccccccCcc-ceeeEEecCcccchhhhhhhhhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEecCCC
Q 042412            2 LLSDYNYTMGK-KIEIKKIADAKARQVTYAKRKKSLIKKAREISVACGIDLVLITFSPTKRGRSTKFCSMK   71 (74)
Q Consensus         2 ~~~~~k~~mgR-Ki~ik~I~~~~~R~~tf~KRk~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s~~   71 (74)
                      +...-|++.|| ||+|+||+|+-+|.+||+|||.|+||||+||++|+|.+|.|+|.++.  |.+|+|++|.
T Consensus        54 ~~~~~k~~~gr~kik~eyIenK~rR~~tFSKRK~GImKKAyELs~LTGtqVllLVaSEt--GhVyTFaTpK  122 (338)
T KOG0015|consen   54 QKDGGKKTTGRVKIKMEYIENKLRRYVTFSKRKTGIMKKAYELSTLTGTQVLLLVASET--GHVYTFATPK  122 (338)
T ss_pred             ccCCCccccceeeccchhhcccceeeeeehhhhhhhHHHHHHhhhcccceEEEEEEecC--cceEEecccc
Confidence            34556888999 99999999999999999999999999999999999999999999999  9999999885


No 8  
>COG5068 ARG80 Regulator of arginine metabolism and related MADS box-containing transcription factors [Transcription]
Probab=99.48  E-value=3.4e-14  Score=108.19  Aligned_cols=61  Identities=36%  Similarity=0.518  Sum_probs=59.3

Q ss_pred             cCcc-ceeeEEecCcccchhhhhhhhhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEecCCC
Q 042412            9 TMGK-KIEIKKIADAKARQVTYAKRKKSLIKKAREISVACGIDLVLITFSPTKRGRSTKFCSMK   71 (74)
Q Consensus         9 ~mgR-Ki~ik~I~~~~~R~~tf~KRk~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s~~   71 (74)
                      .||| |+.|.+|+|+.+|.+||.||+.|++|||+||++|+|.+|.+++.++.  |.++.|+.|+
T Consensus        80 ~~~~~~~~is~i~nk~~r~vtf~Krk~gI~kka~ElsvLt~~~vl~lvise~--g~v~tf~tp~  141 (412)
T COG5068          80 SVTGRKIGISYITNKTKRSVTFSKRKHGINKKAFELSVLTGTEVLLLVISEN--GLVHTFTTPK  141 (412)
T ss_pred             ccccccCCcccccCcccccchhhhhhhhhhhhhhhhhhccCCceEEEEecCC--CceeeecCCc
Confidence            6888 99999999999999999999999999999999999999999999999  9999999986


No 9  
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=56.15  E-value=18  Score=18.92  Aligned_cols=24  Identities=17%  Similarity=0.516  Sum_probs=16.8

Q ss_pred             hhhhhcCccEEEEEecCCCCCCeEEe
Q 042412           42 EISVACGIDLVLITFSPTKRGRSTKF   67 (74)
Q Consensus        42 ELs~Lc~~~v~liv~~~~~~g~~~~~   67 (74)
                      .|+--||+-|...+|+..  |..-+|
T Consensus         2 hlcpkcgvgvl~pvy~~k--geikvf   25 (36)
T PF09151_consen    2 HLCPKCGVGVLEPVYNQK--GEIKVF   25 (36)
T ss_dssp             -B-TTTSSSBEEEEE-TT--S-EEEE
T ss_pred             ccCCccCceEEEEeecCC--CcEEEE
Confidence            467789999999999999  765555


No 10 
>PF13540 RCC1_2:  Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=39.84  E-value=34  Score=16.57  Aligned_cols=25  Identities=20%  Similarity=0.166  Sum_probs=15.9

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecCCC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCSMK   71 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s~~   71 (74)
                      ++-||..-.+++..+   |.++.|.+.+
T Consensus         3 ~ia~G~~ht~al~~~---g~v~~wG~n~   27 (30)
T PF13540_consen    3 QIACGGYHTCALTSD---GEVYCWGDNN   27 (30)
T ss_dssp             EEEEESSEEEEEE-T---TEEEEEE--T
T ss_pred             EEEecCCEEEEEEcC---CCEEEEcCCc
Confidence            356777777666653   5999998764


No 11 
>PF13252 DUF4043:  Protein of unknown function (DUF4043)
Probab=39.07  E-value=15  Score=27.87  Aligned_cols=31  Identities=16%  Similarity=0.219  Sum_probs=24.0

Q ss_pred             HhHhhhhhcCccEEEEEecCCCCCCeEEecC
Q 042412           39 KAREISVACGIDLVLITFSPTKRGRSTKFCS   69 (74)
Q Consensus        39 Ka~ELs~Lc~~~v~liv~~~~~~g~~~~~~s   69 (74)
                      .+-.-++|||++++++.|+...++..|.|.-
T Consensus       270 ~~v~ralLlGaQA~~~A~G~~~~~~~~~w~E  300 (341)
T PF13252_consen  270 VAVARALLLGAQALVIAFGKSGSGMRFFWVE  300 (341)
T ss_pred             cceeeeeeechhheeeeeeccCCCcccccch
Confidence            3445689999999999999954477777763


No 12 
>PF10491 Nrf1_DNA-bind:  NLS-binding and DNA-binding and dimerisation domains of Nrf1;  InterPro: IPR019525  Nuclear respiratory factor-1 is a transcriptional activator that has been implicated in the nuclear control of respiratory chain expression in vertebrates. The first 26 amino acids of nuclear respiratory factor-1 are required for the binding of dynein light chain. The interaction with dynein light chain is observed for both ewg and Nrf-1, transcription factors that are structurally and functionally similar between humans and Drosophila [].  In Drosophila, the erect wing (ewg) protein is required for proper development of the central nervous system and the indirect flight muscles. The fly ewg gene encodes a novel DNA-binding domain that is also found in four genes previously identified in sea urchin, chicken, zebrafish, and human []. The highest level of expression of both ewg and Nrf-1 was found in the central nervous system, somites, first branchial arch, optic vesicle, and otic vesicle. In the mouse Nrf-1 protein, Q8C4C0 from SWISSPROT, there is also an NLS domain at 88-116, and a DNA binding and dimerisation domain at 127-282. Ewg is a site-specific transcriptional activator, and evolutionarily conserved regions of ewg contribute both positively and negatively to transcriptional activity []. 
Probab=38.15  E-value=80  Score=22.85  Aligned_cols=28  Identities=25%  Similarity=0.472  Sum_probs=22.6

Q ss_pred             hHHHH----hHhhhhhcCccEEEEEecCCCCC
Q 042412           35 SLIKK----AREISVACGIDLVLITFSPTKRG   62 (74)
Q Consensus        35 GL~KK----a~ELs~Lc~~~v~liv~~~~~~g   62 (74)
                      -|+.|    ..|+++-+|-++.+++++|+.++
T Consensus        36 rllrkl~~~~de~~trvGqqavvl~~~p~kp~   67 (214)
T PF10491_consen   36 RLLRKLRQTIDEYTTRVGQQAVVLCCTPSKPN   67 (214)
T ss_pred             HHHHHHHHHHHHHHHhhhceeEEEEecCCCCC
Confidence            35555    47999999999999999999543


No 13 
>PRK09555 feoA ferrous iron transport protein A; Reviewed
Probab=36.88  E-value=88  Score=18.40  Aligned_cols=33  Identities=12%  Similarity=0.225  Sum_probs=28.0

Q ss_pred             hhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEec
Q 042412           34 KSLIKKAREISVACGIDLVLITFSPTKRGRSTKFC   68 (74)
Q Consensus        34 ~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~   68 (74)
                      ..+..+-.+|-++.|++|-++-..|-  |.|..+.
T Consensus        20 ~~~~~rL~~mGl~pG~~V~v~~~aP~--gdPi~i~   52 (74)
T PRK09555         20 PAYRQKLLSLGMLPGSSFNVVRVAPL--GDPIHIE   52 (74)
T ss_pred             hHHHHHHHHcCCCCCCEEEEEEECCC--CCCEEEE
Confidence            45778889999999999999999998  6777664


No 14 
>TIGR01916 F420_cofE F420-0:gamma-glutamyl ligase. This model represents an enzyme of coenzyme F(420) biosynthesis, as catalyzed by MJ0768 of Methanococcus jannaschii and by the N-terminal half of FbiB of Mycobacterium bovis strain BCG. Note that only two glutamates are ligated in M. jannaschii, but five to six in the Mycobacterium lineage. In M. jannaschii, CofE catalyzes the GTP-dependent addition of two L-glutamates.
Probab=30.19  E-value=61  Score=23.68  Aligned_cols=27  Identities=19%  Similarity=0.289  Sum_probs=21.9

Q ss_pred             hhhhhcCccEEEEEecCCCCCCeEEecCC
Q 042412           42 EISVACGIDLVLITFSPTKRGRSTKFCSM   70 (74)
Q Consensus        42 ELs~Lc~~~v~liv~~~~~~g~~~~~~s~   70 (74)
                      +|.-.+|++|++||.+..  |.++--+.+
T Consensus       134 ~l~~~~g~~v~VIItDt~--gr~~R~G~~  160 (243)
T TIGR01916       134 GLRELTGVDVGVIITDTN--GRPFREGQV  160 (243)
T ss_pred             HHHHHHCCCEEEEEECCC--CCccccCCC
Confidence            466679999999999888  888876654


No 15 
>CHL00082 psbZ photosystem II protein Z
Probab=29.59  E-value=34  Score=20.19  Aligned_cols=13  Identities=23%  Similarity=0.355  Sum_probs=8.7

Q ss_pred             CCeEEecCCCCCC
Q 042412           62 GRSTKFCSMKRFK   74 (74)
Q Consensus        62 g~~~~~~s~~~~~   74 (74)
                      |-|..|+||++|+
T Consensus        22 gVPV~~Asp~~W~   34 (62)
T CHL00082         22 GVPVVFASPDGWS   34 (62)
T ss_pred             eeeeEEECCCcch
Confidence            4567777777664


No 16 
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily. Members of this group seem to perform a variety of functions, and have been implicated in neuronal organelle transport and chromosome segregation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain,
Probab=27.32  E-value=68  Score=23.37  Aligned_cols=27  Identities=11%  Similarity=0.309  Sum_probs=23.0

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecCC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCSM   70 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s~   70 (74)
                      +++-|.++++++|+....|+.|+...+
T Consensus        68 ~~~~G~n~~i~ayG~tgSGKT~Tm~G~   94 (341)
T cd01372          68 GLFEGYNATVLAYGQTGSGKTYTMGTA   94 (341)
T ss_pred             HHhCCCccceeeecCCCCCCcEEecCC
Confidence            568899999999999877899887654


No 17 
>PF15119 APOC4:  Apolipoprotein C4
Probab=27.13  E-value=41  Score=21.41  Aligned_cols=20  Identities=30%  Similarity=0.650  Sum_probs=15.8

Q ss_pred             hhhhhhhHHHHhHhhh--hhcC
Q 042412           29 YAKRKKSLIKKAREIS--VACG   48 (74)
Q Consensus        29 f~KRk~GL~KKa~ELs--~Lc~   48 (74)
                      ...-|..|++||+.||  +||+
T Consensus        75 l~sSkd~llnk~~sLCPrllC~   96 (99)
T PF15119_consen   75 LRSSKDSLLNKTHSLCPRLLCG   96 (99)
T ss_pred             HHHhHHHHHHHHHhhCchhhcc
Confidence            4567899999999985  5665


No 18 
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins. KIF1A (Unc104) transports synaptic vesicles to the nerve  terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively.
Probab=26.97  E-value=77  Score=23.43  Aligned_cols=35  Identities=17%  Similarity=0.357  Sum_probs=25.6

Q ss_pred             hhHHHHhH-hh--hhhcCccEEEEEecCCCCCCeEEec
Q 042412           34 KSLIKKAR-EI--SVACGIDLVLITFSPTKRGRSTKFC   68 (74)
Q Consensus        34 ~GL~KKa~-EL--s~Lc~~~v~liv~~~~~~g~~~~~~   68 (74)
                      .-+++.+. ++  +++-|.++++++|+....|+.|+--
T Consensus        70 ~~vf~~~~~p~v~~~l~G~n~~i~ayGqtGSGKT~Tm~  107 (356)
T cd01365          70 EDVFEDLGRELLDHAFEGYNVCLFAYGQTGSGKSYTMM  107 (356)
T ss_pred             HHHHHHHHHHHHHHHhCCCceEEEEecCCCCCCeEEec
Confidence            44555542 22  5789999999999999778888654


No 19 
>cd01363 Motor_domain Myosin and Kinesin motor domain. These ATPases belong to the P-loop NTPase family and provide the driving force in myosin and kinesin mediated processes.
Probab=26.65  E-value=80  Score=21.02  Aligned_cols=33  Identities=12%  Similarity=0.342  Sum_probs=23.5

Q ss_pred             HHHHhHhh--hhhcCccEEEEEecCCCCCCeEEec
Q 042412           36 LIKKAREI--SVACGIDLVLITFSPTKRGRSTKFC   68 (74)
Q Consensus        36 L~KKa~EL--s~Lc~~~v~liv~~~~~~g~~~~~~   68 (74)
                      +|..+.++  +++.|-+.++++|+....|+.|+--
T Consensus         8 vf~~~~~~v~~~~~G~n~~i~~yG~tGsGKT~Tm~   42 (186)
T cd01363           8 VFRDVGPLLQSALDGYNVCIFAYGQTGSGKTYTME   42 (186)
T ss_pred             HHHHHHHHHHHHhCCcceeEEEECCCCCcceEecC
Confidence            44444433  5678999999999999767776643


No 20 
>PRK13293 F420-0--gamma-glutamyl ligase; Reviewed
Probab=26.38  E-value=72  Score=23.34  Aligned_cols=27  Identities=15%  Similarity=0.145  Sum_probs=21.7

Q ss_pred             hhhhhcCccEEEEEecCCCCCCeEEecCC
Q 042412           42 EISVACGIDLVLITFSPTKRGRSTKFCSM   70 (74)
Q Consensus        42 ELs~Lc~~~v~liv~~~~~~g~~~~~~s~   70 (74)
                      +|.-.+|++|++||.+..  |+++-.+..
T Consensus       135 ~l~~~~g~~v~VIItDt~--gr~~R~G~t  161 (245)
T PRK13293        135 GLEELTGKKVGVIITDTN--GRPFRKGQR  161 (245)
T ss_pred             HHHHHHCCCEEEEEEcCC--CcccccCCc
Confidence            466679999999999888  888876654


No 21 
>cd00106 KISc Kinesin motor domain. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coil
Probab=26.25  E-value=83  Score=22.59  Aligned_cols=26  Identities=19%  Similarity=0.337  Sum_probs=20.9

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCS   69 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s   69 (74)
                      +++-|.++++++|++...|+.|+.-.
T Consensus        73 ~~~~G~~~~i~~yG~tgSGKT~tl~G   98 (328)
T cd00106          73 SVLEGYNGTIFAYGQTGSGKTYTMFG   98 (328)
T ss_pred             HHhCCCceeEEEecCCCCCCeEEecC
Confidence            45679999999999997788877543


No 22 
>PF04019 DUF359:  Protein of unknown function (DUF359);  InterPro: IPR007164 This is family of archaebacterial proteins, which are about 170 amino acids in length. They have no known function. The most conserved portion of the protein contains the sequence GEEDL that may be important for its function.
Probab=25.85  E-value=23  Score=23.13  Aligned_cols=16  Identities=19%  Similarity=0.407  Sum_probs=12.5

Q ss_pred             EEecCCCCCCeEEecCCC
Q 042412           54 ITFSPTKRGRSTKFCSMK   71 (74)
Q Consensus        54 iv~~~~~~g~~~~~~s~~   71 (74)
                      +++.|.  |....|++|+
T Consensus        80 il~aP~--gs~V~YGQP~   95 (121)
T PF04019_consen   80 ILYAPE--GSVVLYGQPG   95 (121)
T ss_pred             HHhCCC--CCEEEECCCC
Confidence            456677  8889999987


No 23 
>PRK02576 psbZ photosystem II reaction center protein Z; Provisional
Probab=25.80  E-value=42  Score=19.75  Aligned_cols=12  Identities=17%  Similarity=0.429  Sum_probs=7.0

Q ss_pred             CCeEEecCCCCC
Q 042412           62 GRSTKFCSMKRF   73 (74)
Q Consensus        62 g~~~~~~s~~~~   73 (74)
                      |-|..|+||++|
T Consensus        22 gVPV~~Asp~gW   33 (62)
T PRK02576         22 GVPVAYASPQNW   33 (62)
T ss_pred             eeeeEEECCCcc
Confidence            355666666655


No 24 
>TIGR03043 PS_II_psbZ photosystem II core protein PsbZ. PsbZ is a core protein of photosystem II in thylakoid-containing Cyanobacteria and plant chloroplasts. The original Chlamydomonas gene symbol, ycf9, is a synonym. PsbZ controls the interaction of the reaction center core with the light-harvesting antenna.
Probab=25.60  E-value=43  Score=19.47  Aligned_cols=13  Identities=15%  Similarity=0.220  Sum_probs=8.6

Q ss_pred             CCeEEecCCCCCC
Q 042412           62 GRSTKFCSMKRFK   74 (74)
Q Consensus        62 g~~~~~~s~~~~~   74 (74)
                      |-|..|+||++|+
T Consensus        19 gVPV~~Asp~~W~   31 (58)
T TIGR03043        19 GVPVALASPGGWS   31 (58)
T ss_pred             hceeEEeCCCcch
Confidence            4567777777664


No 25 
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup. Members of this group might play a role in regulating chromosomal movement along microtubules in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through
Probab=25.23  E-value=89  Score=22.72  Aligned_cols=26  Identities=12%  Similarity=0.353  Sum_probs=21.5

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCS   69 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s   69 (74)
                      +++-|.++++++|+....|+.|+...
T Consensus        75 ~~~~G~n~~i~ayG~tgSGKTyTm~G  100 (319)
T cd01376          75 HLLSGQNATVFAYGSTGAGKTHTMLG  100 (319)
T ss_pred             HHhCCCceEEEEECCCCCCCcEEEeC
Confidence            56779999999999997788887643


No 26 
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=24.95  E-value=1.7e+02  Score=18.14  Aligned_cols=38  Identities=11%  Similarity=0.134  Sum_probs=27.0

Q ss_pred             hhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEecCCC
Q 042412           33 KKSLIKKAREISVACGIDLVLITFSPTKRGRSTKFCSMK   71 (74)
Q Consensus        33 k~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s~~   71 (74)
                      -..|..|..|++-+-.-+..-+=+-+.+ |.|.+++|..
T Consensus        22 ~e~L~~~v~~~c~~~~~q~ft~kw~DEE-GDp~tiSS~~   59 (83)
T cd06404          22 LEELCNEVRDMCRFHNDQPFTLKWIDEE-GDPCTISSQM   59 (83)
T ss_pred             HHHHHHHHHHHhCCCCCCcEEEEEECCC-CCceeecCHH
Confidence            4689999999988866544444444443 8999999864


No 27 
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins. Ncd is a spindle motor protein necessary for chromosome segregation in meiosis. KIFC2/KIFC3-like kinesins have been implicated in motility of the Golgi apparatus as well as dentritic and axonal transport in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found at the C-terminus (C-type). C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for mi
Probab=24.71  E-value=1.1e+02  Score=22.23  Aligned_cols=27  Identities=15%  Similarity=0.301  Sum_probs=21.9

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecCC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCSM   70 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s~   70 (74)
                      +++-|.+++++.|++...|+.|+.-.+
T Consensus        72 ~~~~G~~~~i~ayG~tgSGKT~tl~G~   98 (329)
T cd01366          72 SALDGYNVCIFAYGQTGSGKTYTMEGP   98 (329)
T ss_pred             HHhCCCceEEEEeCCCCCCCcEEecCC
Confidence            567899999999999977888865443


No 28 
>COG1918 FeoA Fe2+ transport system protein A [Inorganic ion transport and metabolism]
Probab=24.45  E-value=1.7e+02  Score=17.47  Aligned_cols=45  Identities=16%  Similarity=0.303  Sum_probs=34.3

Q ss_pred             CccceeeEEecCcccchhhhhhhhhhHHHHhHhhhhhcCccEEEEEecCCCCCCeEEe
Q 042412           10 MGKKIEIKKIADAKARQVTYAKRKKSLIKKAREISVACGIDLVLITFSPTKRGRSTKF   67 (74)
Q Consensus        10 mgRKi~ik~I~~~~~R~~tf~KRk~GL~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~   67 (74)
                      .|.+..+..|.-..           ++.+|-.|+-+.-|+++.++-..|-  |.|...
T Consensus         8 ~g~~~~V~~i~~~~-----------~~~~RL~~mG~~~G~~i~vi~~apl--gdPi~v   52 (75)
T COG1918           8 EGEKGRVVSIDGGN-----------GLRRRLLSMGIVPGASITVVRKAPL--GDPILV   52 (75)
T ss_pred             CCceEEEEEecCCH-----------HHHHHHHHcCCCCCCEEEEEEecCC--CCCEEE
Confidence            34455566655433           7889999999999999999999999  666554


No 29 
>COG0139 HisI Phosphoribosyl-AMP cyclohydrolase [Amino acid transport and metabolism]
Probab=24.10  E-value=24  Score=23.07  Aligned_cols=31  Identities=26%  Similarity=0.492  Sum_probs=23.8

Q ss_pred             hhhhhhhHHHH---------hHhhhhhcCccEEEEEecCC
Q 042412           29 YAKRKKSLIKK---------AREISVACGIDLVLITFSPT   59 (74)
Q Consensus        29 f~KRk~GL~KK---------a~ELs~Lc~~~v~liv~~~~   59 (74)
                      ||+-|+-|.+|         +.|+.+-||.|+.++.+.+.
T Consensus        54 ~SRSR~~lW~KGetSG~~q~v~~i~~DCD~Dall~~V~q~   93 (111)
T COG0139          54 YSRSRQELWTKGETSGHTQKVVEIRLDCDGDALLLLVEQI   93 (111)
T ss_pred             EEcchhhheccccccCceEEEEEEEcCCCCCEEEEEEEeC
Confidence            45555545554         57899999999999999885


No 30 
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins. Subgroup of kinesins, which form heterotrimers composed of 2 kinesins and one non-motor accessory subunit. Kinesins II play important roles in ciliary transport, and have been implicated in neuronal transport, melanosome transport, the secretory pathway, and mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this group the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain
Probab=24.04  E-value=81  Score=23.09  Aligned_cols=26  Identities=19%  Similarity=0.305  Sum_probs=22.0

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCS   69 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s   69 (74)
                      +++-|.++++++|+....|+.|+--.
T Consensus        76 ~~~~G~n~~i~ayG~tgSGKTyTm~G  101 (333)
T cd01371          76 SVLEGYNGTIFAYGQTGTGKTFTMEG  101 (333)
T ss_pred             HHhCCCceeEEecCCCCCCCcEeecC
Confidence            67899999999999997788887544


No 31 
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 
Probab=23.29  E-value=78  Score=23.23  Aligned_cols=25  Identities=16%  Similarity=0.294  Sum_probs=21.5

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEec
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFC   68 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~   68 (74)
                      +++.|.++++++|+....|+.|+--
T Consensus        75 ~~~~G~n~~i~ayG~tgSGKTyTm~   99 (334)
T cd01375          75 SALDGYNGTIFAYGQTGAGKTFTMT   99 (334)
T ss_pred             HHhCCCccceeeecCCCCCCeEEcc
Confidence            5789999999999999878888743


No 32 
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup. Members of this group have been associated with organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-c
Probab=23.27  E-value=1.1e+02  Score=22.09  Aligned_cols=27  Identities=15%  Similarity=0.262  Sum_probs=21.8

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecCC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCSM   70 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s~   70 (74)
                      +++-|.++++++|+....|+.|+.-.+
T Consensus        71 ~~~~G~n~~i~ayG~tgSGKT~Tm~G~   97 (325)
T cd01369          71 DVLNGYNGTIFAYGQTGSGKTYTMEGP   97 (325)
T ss_pred             HHHcCccceEEEeCCCCCCceEEecCC
Confidence            467899999999999877888875443


No 33 
>PF00383 dCMP_cyt_deam_1:  Cytidine and deoxycytidylate deaminase zinc-binding region;  InterPro: IPR002125 Cytidine deaminase (3.5.4.5 from EC) (cytidine aminohydrolase) catalyzes the hydrolysis of cytidine into uridine and ammonia while deoxycytidylate deaminase (3.5.4.12 from EC) (dCMP deaminase) hydrolyzes dCMP into dUMP. Both enzymes are known to bind zinc and to require it for their catalytic activity [, ]. These two enzymes do not share any sequence similarity with the exception of a region that contains three conserved histidine and cysteine residues which are thought to be involved in the binding of the catalytic zinc ion. Such a region is also found in other proteins [, ]:  Yeast cytosine deaminase (3.5.4.1 from EC) (gene FCY1) which transforms cytosine into uracil. Mammalian apolipoprotein B mRNA editing protein, responsible for the postranscriptional editing of a CAA codon into a UAA (stop) codon in the APOB mRNA. Riboflavin biosynthesis protein ribG, which converts 2,5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone 5'-phosphate into 5-amino-6-(ribosylamino)-2,4(1H,3H)-pyrimidinedione 5'-phosphate.  Bacillus cereus blasticidin-S deaminase (3.5.4.23 from EC), which catalyzes the deamination of the cytosine moiety of the antibiotics blasticidin S, cytomycin and acetylblasticidin S.  Bacillus subtilis protein comEB. This protein is required for the binding and uptake of transforming DNA. B. subtilis hypothetical protein yaaJ.  Escherichia coli hypothetical protein yfhC. Yeast hypothetical protein YJL035c. ; GO: 0008270 zinc ion binding, 0016787 hydrolase activity; PDB: 3MPZ_C 3R2N_C 1WKQ_A 1TIY_B 2B3J_C 2O7P_B 2OBC_A 2G6V_B 2D30_B 2D5N_B ....
Probab=22.99  E-value=1.7e+02  Score=17.07  Aligned_cols=31  Identities=13%  Similarity=0.255  Sum_probs=21.1

Q ss_pred             hHHHHhHhhhhhc----CccEEEEEecCCCCCCeEEe
Q 042412           35 SLIKKAREISVAC----GIDLVLITFSPTKRGRSTKF   67 (74)
Q Consensus        35 GL~KKa~ELs~Lc----~~~v~liv~~~~~~g~~~~~   67 (74)
                      -+++.|.+++-..    +..|+-++++++  |.....
T Consensus         6 ~~m~~a~~~a~~s~~~~~~~vgaviv~~~--~~~i~~   40 (102)
T PF00383_consen    6 EFMRIAIELAKRSRPCGNFPVGAVIVDPD--GKIIAT   40 (102)
T ss_dssp             HHHHHHHHHHHTHBTTTSSSEEEEEEETT--TEEEEE
T ss_pred             HHHHHHHHHHHhccccCCCCEEEEEEecc--CccEEE
Confidence            3567777766555    778888888876  555443


No 34 
>PRK09732 hypothetical protein; Provisional
Probab=22.79  E-value=2.2e+02  Score=18.66  Aligned_cols=34  Identities=12%  Similarity=0.146  Sum_probs=25.4

Q ss_pred             HHHHhHhhhhhcCccEEEEEecCCCCCCeEEecCCC
Q 042412           36 LIKKAREISVACGIDLVLITFSPTKRGRSTKFCSMK   71 (74)
Q Consensus        36 L~KKa~ELs~Lc~~~v~liv~~~~~~g~~~~~~s~~   71 (74)
                      +..-|.+-+.-=|..|++.|++..  |.+..|--.|
T Consensus        15 ~~~aA~~~A~~~g~~v~iaVvD~~--G~l~a~~RmD   48 (134)
T PRK09732         15 IIAAGQEEAQKNNWSVSIAVADDG--GHLLALSRMD   48 (134)
T ss_pred             HHHHHHHHHHHhCCCEEEEEEcCC--CCEEEEEEcC
Confidence            344455555555889999999999  9999887655


No 35 
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup. Members of this subgroup seem to play a role in mitosis and meiosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second
Probab=21.61  E-value=1.1e+02  Score=22.50  Aligned_cols=27  Identities=11%  Similarity=0.257  Sum_probs=22.2

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecCC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCSM   70 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s~   70 (74)
                      +++-|.++++++|+....|+.|+--.+
T Consensus        69 ~~~~G~n~ti~aYGqTGSGKTyTm~G~   95 (337)
T cd01373          69 DCLSGYNGSIFAYGQTGSGKTYTMMGP   95 (337)
T ss_pred             HHhCCCceeEEEeCCCCCCceEEecCC
Confidence            568899999999999877888876443


No 36 
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to
Probab=21.05  E-value=1e+02  Score=22.33  Aligned_cols=26  Identities=15%  Similarity=0.318  Sum_probs=21.2

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCS   69 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s   69 (74)
                      .++-|.++++++|++...|+.|+...
T Consensus        68 ~~l~G~n~~i~ayG~tgSGKT~T~~G   93 (321)
T cd01374          68 SALEGYNGTIFAYGQTSSGKTFTMSG   93 (321)
T ss_pred             HHHCCCceeEEeecCCCCCCceeccC
Confidence            45779999999999987788887653


No 37 
>smart00129 KISc Kinesin motor, catalytic domain. ATPase. Microtubule-dependent molecular motors that play important roles in intracellular transport of organelles and in cell division.
Probab=21.00  E-value=1.2e+02  Score=21.99  Aligned_cols=25  Identities=20%  Similarity=0.400  Sum_probs=20.7

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEec
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFC   68 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~   68 (74)
                      +++-|.++++++|++...|+.|+-.
T Consensus        74 ~~~~G~~~~i~~yG~tgSGKT~tl~   98 (335)
T smart00129       74 SVLEGYNATIFAYGQTGSGKTYTMS   98 (335)
T ss_pred             HHhcCCceeEEEeCCCCCCCceEec
Confidence            4678999999999999778877654


No 38 
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group. KIF2 is a protein expressed in neurons, which has been associated with axonal transport and neuron development; alternative splice forms have been implicated in lysosomal translocation. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In this subgroup the motor domain is found in the middle (M-type) of the protein chain. M-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second (KIF2 may be slower). To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and lo
Probab=20.49  E-value=1.1e+02  Score=22.39  Aligned_cols=26  Identities=15%  Similarity=0.156  Sum_probs=21.4

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCS   69 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s   69 (74)
                      +++-|.++++++|+....|+.|+--.
T Consensus        79 ~~~~G~n~~i~ayGqtGSGKTyTm~G  104 (322)
T cd01367          79 HVFEGGVATCFAYGQTGSGKTYTMLG  104 (322)
T ss_pred             HHhCCCceEEEeccCCCCCCceEecC
Confidence            56789999999999987788887543


No 39 
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup. Members of this group may play a role in mitosis. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, a
Probab=20.26  E-value=1.3e+02  Score=22.26  Aligned_cols=26  Identities=19%  Similarity=0.355  Sum_probs=21.5

Q ss_pred             hhhcCccEEEEEecCCCCCCeEEecC
Q 042412           44 SVACGIDLVLITFSPTKRGRSTKFCS   69 (74)
Q Consensus        44 s~Lc~~~v~liv~~~~~~g~~~~~~s   69 (74)
                      +++-|..+++++|+....|+.|+-..
T Consensus        83 ~~l~G~n~ti~aYGqtGSGKTyTm~G  108 (345)
T cd01368          83 DLLKGKNSLLFTYGVTNSGKTYTMQG  108 (345)
T ss_pred             HHhCCCceEEEEeCCCCCCCeEEecC
Confidence            56789999999999997788887543


Done!