Citrus Sinensis ID: 042424


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MEESQTPGKRKAPKADSHVRGTPKEESTKKQRNPTRSCVHEVAVPSCYTLTTDETTHGTLTNPVYNGKTAVAEYAIAMAFRDKQRVIYTSSLKALSNQKYRELHKEFKDVGLMTGDVTLSPNASCLVMTTEILRGMLY
cccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEEEccccccHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHcccccccccccEEcccccEEEEEHHHHHHccc
*********************************PTRSCVHEVAVPSCYTLTTDETTHGTLTNPVYNGKTAVAEYAIAMAFRDKQRVIYTSSLKALSNQKYRELHKEFKDVGLMTGDVTLSPNASCLVMTTEILRGMLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEESQTPGKRKAPKADSHVRGTPKEESTKKQRNPTRSCVHEVAVPSCYTLTTDETTHGTLTNPVYNGKTAVAEYAIAMAFRDKQRVIYTSSLKALSNQKYRELHKEFKDVGLMTGDVTLSPNASCLVMTTEILRGMLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Superkiller viralicidic activity 2-like 2 May be involved in pre-mRNA splicing. Associated with the RNA exosome complex and involved in the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA.probableP42285
Superkiller viralicidic activity 2-like 2 May be involved in pre-mRNA splicing. Associated with the RNA exosome complex and involved in the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA.probableQ9CZU3
ATP-dependent RNA helicase DOB1 ATP-dependent RNA helicase required for the 3'-end formation of 5.8S RNA. Cofactor for the exosome complex that unwinds secondary structure in pre-rRNA. Required for nucleocytoplasmic transport of mRNA. May serve as a chaperone which translocates or normalizes the structure of mRNAs in preparation for export. Component of the TRAMP complex which has a poly(A) RNA polymerase activity and is involved in a post-transcriptional quality control mechanism limiting inappropriate expression of genetic information. Polyadenylation is required for the degradative activity of the exosome on several of its nuclear RNA substrates.probableP47047

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L9O, chain A
Confidence level:very confident
Coverage over the Query: 56-138
View the alignment between query and template
View the model in PyMOL