BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 042449
(90 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3AZX|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
pdb|3AZX|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
pdb|3AZY|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
pdb|3AZY|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
pdb|3AZY|C Chain C, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
pdb|3AZY|D Chain D, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
pdb|3AZZ|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8 In Complex With
Gluconolactone
pdb|3AZZ|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8 In Complex With
Gluconolactone
pdb|3AZZ|C Chain C, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8 In Complex With
Gluconolactone
pdb|3AZZ|D Chain D, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8 In Complex With
Gluconolactone
pdb|3B00|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8 In Complex With
Cetyltrimethylammonium Bromide
pdb|3B00|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8 In Complex With
Cetyltrimethylammonium Bromide
pdb|3B00|C Chain C, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8 In Complex With
Cetyltrimethylammonium Bromide
pdb|3B00|D Chain D, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8 In Complex With
Cetyltrimethylammonium Bromide
pdb|3B01|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
pdb|3B01|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
pdb|3B01|C Chain C, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
pdb|3B01|D Chain D, Crystal Structure Of The Laminarinase Catalytic Domain
From Thermotoga Maritima Msb8
Length = 272
Score = 27.3 bits (59), Expect = 2.5, Method: Composition-based stats.
Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 3/41 (7%)
Query: 11 DTRPRQGETVVPGGTGGKSLEAQEHLAEG---FSGKNHVVA 48
DTR G PG +GG S+ HL EG FS H+ +
Sbjct: 142 DTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFS 182
>pdb|3BTN|A Chain A, Crystal Structure Of Antizyme Inhibitor, An Ornithine
Decarboxylase Homologous Protein
pdb|3BTN|B Chain B, Crystal Structure Of Antizyme Inhibitor, An Ornithine
Decarboxylase Homologous Protein
Length = 448
Score = 26.9 bits (58), Expect = 2.9, Method: Composition-based stats.
Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
Query: 22 PGGTGGK--SLEAQEHLAEGFSGKNHVVAKRLVANDSISTSVHSTCRVSHARLVHMNRG 78
P G+G + S +++ F+ +++AK++V ND S+ V A + +MN G
Sbjct: 261 PEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSSGVEKNGSDEPAFVYYMNDG 319
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.129 0.369
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,766,328
Number of Sequences: 62578
Number of extensions: 93497
Number of successful extensions: 226
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 222
Number of HSP's gapped (non-prelim): 4
length of query: 90
length of database: 14,973,337
effective HSP length: 57
effective length of query: 33
effective length of database: 11,406,391
effective search space: 376410903
effective search space used: 376410903
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)