BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042449
         (90 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3AZX|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
 pdb|3AZX|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
 pdb|3AZY|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
 pdb|3AZY|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
 pdb|3AZY|C Chain C, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
 pdb|3AZY|D Chain D, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
 pdb|3AZZ|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8 In Complex With
           Gluconolactone
 pdb|3AZZ|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8 In Complex With
           Gluconolactone
 pdb|3AZZ|C Chain C, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8 In Complex With
           Gluconolactone
 pdb|3AZZ|D Chain D, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8 In Complex With
           Gluconolactone
 pdb|3B00|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8 In Complex With
           Cetyltrimethylammonium Bromide
 pdb|3B00|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8 In Complex With
           Cetyltrimethylammonium Bromide
 pdb|3B00|C Chain C, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8 In Complex With
           Cetyltrimethylammonium Bromide
 pdb|3B00|D Chain D, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8 In Complex With
           Cetyltrimethylammonium Bromide
 pdb|3B01|A Chain A, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
 pdb|3B01|B Chain B, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
 pdb|3B01|C Chain C, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
 pdb|3B01|D Chain D, Crystal Structure Of The Laminarinase Catalytic Domain
           From Thermotoga Maritima Msb8
          Length = 272

 Score = 27.3 bits (59), Expect = 2.5,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 3/41 (7%)

Query: 11  DTRPRQGETVVPGGTGGKSLEAQEHLAEG---FSGKNHVVA 48
           DTR   G    PG +GG S+    HL EG   FS   H+ +
Sbjct: 142 DTRTVYGTAHGPGYSGGASIGVAYHLPEGVPDFSEDFHIFS 182


>pdb|3BTN|A Chain A, Crystal Structure Of Antizyme Inhibitor, An Ornithine
           Decarboxylase Homologous Protein
 pdb|3BTN|B Chain B, Crystal Structure Of Antizyme Inhibitor, An Ornithine
           Decarboxylase Homologous Protein
          Length = 448

 Score = 26.9 bits (58), Expect = 2.9,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 22  PGGTGGK--SLEAQEHLAEGFSGKNHVVAKRLVANDSISTSVHSTCRVSHARLVHMNRG 78
           P G+G +  S     +++  F+   +++AK++V ND  S+ V        A + +MN G
Sbjct: 261 PEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSSGVEKNGSDEPAFVYYMNDG 319


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.129    0.369 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,766,328
Number of Sequences: 62578
Number of extensions: 93497
Number of successful extensions: 226
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 222
Number of HSP's gapped (non-prelim): 4
length of query: 90
length of database: 14,973,337
effective HSP length: 57
effective length of query: 33
effective length of database: 11,406,391
effective search space: 376410903
effective search space used: 376410903
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)