Citrus Sinensis ID: 042465

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----

MDAFGNPLKQSNDFELHEFIDDQNFDQFIDLIRGENEDPFATFDCRVISGCCDDSSTTPDSHLFDLSAAESTEVTDHNNFVLNSSTLSSLKIGGDVKEGDHYDEDNDGNDASGAARTTTIIDASSKKPKGDHRSRTLISEQKRRGKMKEKLYQLRALVPNITKMDKASLVGDAVSYVQELQTTAKNLKAEIADLEASSGSSENWNESIENTKNTQIQSNSTNSRKKIIMQMDVFQVEERGFYLKLVSNKGEGVAASLYEALESLTSFNVQNSNLVAESERFVLTFTLNAKDNDQISMQLPNLKLWVANALLNQGFQVLITPLSA

cccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEEEccEEEEEEEEcccccHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEEEEEccccccccccccHHHHHHHHHHHcccEEEcccccc

******P*KQSNDFELHEFIDDQNFDQFIDLIRGENEDPFATFDCRVISGCCDD*************************FV******************************************************************KEKLYQLRALVPNITKMDKASLVGDAVSYVQELQT********************************************IIMQMDVFQVEERGFYLKLVSNKGEGVAASLYEALESLTSFNVQNSNLVAESERFVLTFTLNAKDNDQISMQLPNLKLWVANALLNQGFQVLITP***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDAFGNPLKQSNDFELHEFIDDQNFDQFIDLIRGENEDPFATFDCRVISGCCDDSSTTPDSHLFDLSAAESTEVTDHNNFVLNSSTLSSLKIGGDVKEGDHYDEDNDGNDASGAARTTTIIDASSKKPKGDHRSRTLISEQKRRGKMKEKLYQLRALVPNITKMDKASLVGDAVSYxxxxxxxxxxxxxxxxxxxxxSGSSENWNESIENTKNTQIQSNSTNSRKKIIMQMDVFQVEERGFYLKLVSNKGEGVAASLYEALESLTSFNVQNSNLVAESERFVLTFTLNAKDNDQISMQLPNLKLWVANALLNQGFQVLITPLSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR	Transcription factor. Essential protein involved in iron uptake responses. Regulates FRO2 at the level of mRNA accumulation and IRT1 at the level of protein accumulation. Confers enhanced iron mobilization responses at low iron supply.	probable	Q0V7X4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AM9, chain A
Confidence level:confident
Coverage over the Query: 132-198
View the alignment between query and template
View the model in PyMOL

Template: 3LOU, chain A
Confidence level:probable
Coverage over the Query: 239-314
View the alignment between query and template
View the model in PyMOL