Citrus Sinensis ID: 042473

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41

MFERKFYKTRICVLYQKGRCSRPTCSFAHGDAELRRPFRSHHGGPDYRVGDLRDKLDRRLSPQKIYSPGRDTRGRNRFRGLSPSRSPENKSDRKRWKKQHLDGPREFSASLKISDGINDRVKERKFTPSDSKVVLLEQLKEVQLDINVLEDRKLQLETNEEEKGQEADILSSRIKELETQLQKEKEESKRIASKIKKFVKAHNRHSQMQDDLKRSQARLQKLGYHLGLDATKVGGNEEDSSINIMSDEETTNYHLVDPQNEKQTIPSPNKKKLHVDRDTTNGFVPEANLTKDGGRVAESVHLKEVSWWNQHPTNHGSVADESKLKGKNVSTSWFSAQAKNVRSANALALPSTGIAAHVNDEEIEVEVEQIEEIDMASAGTGKGATYMAKGLQFRLPPPLPIPRNAYIE

ccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHccccccccccHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccc

****KFYKTRICVLYQKGRCSRPTCSFAHGD*****************************************************************************************************VVLLEQLKEVQLDINVL*************************************************VK*********************LGYHLGL*******************************************************************VAESVHLKEVSWWNQ**********************WF**********NALALPSTGIAAHVNDEEIEVEVEQIEEID*********ATYMAKGLQF***************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFERKFYKTRICVLYQKGRCSRPTCSFAHGDAELRRPFRSHHGGPDYRVGDLRDKLDRRLSPQKIYSPGRDTRGRNRFRGLSPSRSPENKSDRKRWKKQHLDGPREFSASLKISDGINDRVKERKFTPSDSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIKKFVKAHNRHSQMQDDLKRSQARLQKLGYHLGLDATKVGGNEEDSSINIMSDEETTNYHLVDPQNEKQTIPSPNKKKLHVDRDTTNGFVPEANLTKDGGRVAESVHLKEVSWWNQHPTNHGSVADESKLKGKNVSTSWFSAQAKNVRSANALALPSTGIAAHVNDEEIEVEVEQIEEIDMASAGTGKGATYMAKGLQFRLPPPLPIPRNAYIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Zinc finger CCCH domain-containing protein 13		probable	Q6H7U2
Zinc finger CCCH domain-containing protein 40		probable	Q93XW7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:confident
Coverage over the Query: 1-38
View the alignment between query and template
View the model in PyMOL

Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 212-231
View the alignment between query and template
View the model in PyMOL

Template: 1C1G, chain A
Confidence level:probable
Coverage over the Query: 153-159
View the alignment between query and template
View the model in PyMOL

Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 137-198
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1i84, chain S		probable	Alignment \| Template Structure