Query         042525
Match_columns 68
No_of_seqs    111 out of 317
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 07:04:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042525.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042525hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03492 Methyltransf_7:  SAM d 100.0 1.1E-36 2.4E-41  223.9   3.0   68    1-68     54-128 (334)
  2 PLN02668 indole-3-acetate carb 100.0 4.8E-35   1E-39  221.0   5.0   67    1-67    100-182 (386)
  3 PF08241 Methyltransf_11:  Meth  86.7    0.63 1.4E-05   26.1   2.1   28   33-60     46-73  (95)
  4 KOG2940 Predicted methyltransf  86.0    0.22 4.7E-06   37.8  -0.2   24   43-66    133-156 (325)
  5 cd05721 IgV_CTLA-4 Immunoglobu  68.9     3.3 7.2E-05   27.2   1.5   26   42-67     10-43  (115)
  6 KOG3010 Methyltransferase [Gen  63.1     2.9 6.4E-05   31.2   0.5   17   44-60     97-113 (261)
  7 COG2226 UbiE Methylase involve  55.1     3.4 7.3E-05   29.9  -0.4   32   36-67    108-139 (238)
  8 PF13489 Methyltransf_23:  Meth  55.1     8.8 0.00019   23.6   1.6   22   41-62     72-93  (161)
  9 PRK05785 hypothetical protein;  53.2     4.1   9E-05   28.3  -0.2   29   36-64     99-127 (226)
 10 PRK10258 biotin biosynthesis p  53.2     9.3  0.0002   26.2   1.6   21   42-62     98-118 (251)
 11 PRK14103 trans-aconitate 2-met  52.3     8.5 0.00019   26.6   1.3   26   36-62     79-104 (255)
 12 PLN02232 ubiquinone biosynthes  48.2      13 0.00028   24.3   1.6   27   36-62     33-59  (160)
 13 PRK01683 trans-aconitate 2-met  47.0      13 0.00028   25.5   1.5   22   41-62     87-108 (258)
 14 TIGR02072 BioC biotin biosynth  45.8      13 0.00029   24.3   1.4   27   36-62     87-113 (240)
 15 KOG1541 Predicted protein carb  41.3      15 0.00032   27.7   1.2   22   42-63    107-128 (270)
 16 TIGR02727 MTHFS_bact 5,10-meth  39.5      13 0.00028   24.8   0.6   38   28-66    129-169 (181)
 17 TIGR03488 cas_Cas5p CRISPR-ass  39.3       5 0.00011   29.2  -1.5   30   30-59     28-58  (237)
 18 PLN02233 ubiquinone biosynthes  39.0      22 0.00048   25.1   1.7   20   43-62    141-160 (261)
 19 PF08436 DXP_redisom_C:  1-deox  38.3      12 0.00026   23.7   0.3   26   16-41      8-38  (84)
 20 PRK10333 5-formyltetrahydrofol  37.8      15 0.00032   24.9   0.6   38   28-66    123-164 (182)
 21 PF08242 Methyltransf_12:  Meth  37.7      17 0.00036   21.1   0.8   16   46-61     65-80  (99)
 22 PRK06202 hypothetical protein;  36.8      20 0.00043   24.4   1.2   19   44-62    126-144 (232)
 23 TIGR02081 metW methionine bios  34.4      22 0.00048   23.5   1.1   20   43-62     71-90  (194)
 24 TIGR02752 MenG_heptapren 2-hep  31.1      46 0.00099   22.3   2.2   29   34-62    101-129 (231)
 25 TIGR03127 RuMP_HxlB 6-phospho   28.5      19 0.00041   23.6  -0.0   29   11-39     15-43  (179)
 26 PF06441 EHN:  Epoxide hydrolas  25.6      35 0.00077   21.8   0.9   12   29-40     96-107 (112)
 27 PF01209 Ubie_methyltran:  ubiE  24.4      60  0.0013   22.9   1.9   27   36-62    105-131 (233)
 28 cd05005 SIS_PHI Hexulose-6-pho  24.0      20 0.00044   23.5  -0.5   29   11-39     18-46  (179)
 29 PRK10886 DnaA initiator-associ  21.9      45 0.00097   23.2   0.9   15   23-37     38-52  (196)
 30 COG0743 Dxr 1-deoxy-D-xylulose  20.8      66  0.0014   25.4   1.7   27   15-41    148-179 (385)
 31 PF01812 5-FTHF_cyc-lig:  5-for  20.2      27 0.00059   23.1  -0.5   38   28-65    131-173 (186)

No 1  
>PF03492 Methyltransf_7:  SAM dependent carboxyl methyltransferase;  InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesized through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyses the second step to produce theobromine [].; GO: 0008168 methyltransferase activity; PDB: 2EFJ_A 1M6E_X 2EG5_C 3B5I_B.
Probab=100.00  E-value=1.1e-36  Score=223.88  Aligned_cols=68  Identities=54%  Similarity=0.940  Sum_probs=53.6

Q ss_pred             CceEEEEeCCCCCCcHHHHhhcCCCC-------ccceEEecccccccccccCCceeEEEcccccccccCCCCCCC
Q 042525            1 TQEFRIFFNDHTSNDFNTLFKSLPPE-------RNYFAASVPGAFYGALISQGIIASVNSSHSVRWLSSVPNEVE   68 (68)
Q Consensus         1 ~~e~~v~~nDlP~NDFn~lF~~l~~~-------~~~f~~~vpgSFy~rlfP~~Svh~~~Ss~alhWLS~~P~~l~   68 (68)
                      +|||||+|||||+||||+||++|++.       ++||++|||||||+||||++||||+||++|||||||+|+++.
T Consensus        54 ~~e~~v~~nDlP~NDFn~lF~~l~~~~~~~~~~~~~f~~gvpgSFy~rLfP~~Svh~~~Ss~alHWLS~vP~~l~  128 (334)
T PF03492_consen   54 PPEFQVFFNDLPSNDFNTLFKSLPSFQQSLKKFRNYFVSGVPGSFYGRLFPSNSVHFGHSSYALHWLSQVPEELV  128 (334)
T ss_dssp             --EEEEEEEE-TTS-HHHHHHCHHHHHHHHHHTTSEEEEEEES-TTS--S-TT-EEEEEEES-TTB-SSS-CCCC
T ss_pred             CCeEEEEeCCCCCccHHHHHHhChhhhhccCCCceEEEEecCchhhhccCCCCceEEEEEechhhhcccCCcccc
Confidence            48999999999999999999999876       699999999999999999999999999999999999999873


No 2  
>PLN02668 indole-3-acetate carboxyl methyltransferase
Probab=100.00  E-value=4.8e-35  Score=221.03  Aligned_cols=67  Identities=54%  Similarity=0.924  Sum_probs=62.6

Q ss_pred             CceEEEEeCCCCCCcHHHHhhcCCCC----------------ccceEEecccccccccccCCceeEEEcccccccccCCC
Q 042525            1 TQEFRIFFNDHTSNDFNTLFKSLPPE----------------RNYFAASVPGAFYGALISQGIIASVNSSHSVRWLSSVP   64 (68)
Q Consensus         1 ~~e~~v~~nDlP~NDFn~lF~~l~~~----------------~~~f~~~vpgSFy~rlfP~~Svh~~~Ss~alhWLS~~P   64 (68)
                      +||+||++||||+||||+||++|+++                ++||++|||||||+||||++||||+||++|||||||+|
T Consensus       100 ~pe~qv~~nDLP~NDFNtlF~~L~~~~~~~~~~~~~~~~~~~~~~f~~gvpGSFY~RLfP~~Slh~~~Ss~slHWLS~vP  179 (386)
T PLN02668        100 PPEFSAFFSDLPSNDFNTLFQLLPPLANYGGSMEECLAASGHRSYFAAGVPGSFYRRLFPARSIDVFHSAFSLHWLSQVP  179 (386)
T ss_pred             CCcceEEecCCCCCCHHHHHhhchhhhhhhcchhhhccccCCCceEEEecCccccccccCCCceEEEEeeccceecccCc
Confidence            47999999999999999999999752                24999999999999999999999999999999999999


Q ss_pred             CCC
Q 042525           65 NEV   67 (68)
Q Consensus        65 ~~l   67 (68)
                      +++
T Consensus       180 ~~l  182 (386)
T PLN02668        180 ESV  182 (386)
T ss_pred             hhh
Confidence            986


No 3  
>PF08241 Methyltransf_11:  Methyltransferase domain;  InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. This entry represents a methyltransferase domain found in a large variety of SAM-dependent methyltransferases including, but not limited to:  Arsenite methyltransferase (2.1.1.137 from EC) which converts arsenical compounds to their methylated forms [] Biotin synthesis protein bioC, which is involved in the early stages of biotin biosyntheis [] Arginine N-methyltransferase 1, an arginine-methylating enzyme which acts on residues present in a glycine and argine-rich domain and can methylate histones [] Hexaprenyldihydroxybenzoate methyltransferase (2.1.1.114 from EC), a mitochodrial enzyme involved in ubiquinone biosynthesis []  A probable cobalt-precorrin-6Y C(15)-methyltransferase thought to be involved in adenosylcobalamin biosynthesis [] Sterol 24-C-methyltransferase (2.1.1.41 from EC), shown to participate in ergosterol biosynthesis [] 3-demethylubiquinone-9 3-methyltransferase (2.1.1.64 from EC) involved in ubiquinone biosynthesis []  Structural studies show that this domain forms the Rossman-like alpha-beta fold typical of SAM-dependent methyltransferases [, , ]. ; GO: 0008168 methyltransferase activity, 0008152 metabolic process; PDB: 3CGG_B 3CCF_B 3BKW_B 2PXX_A 3I9F_A 2YQZ_B 2YR0_A 3BUS_A 3EGE_A 3G5L_B ....
Probab=86.71  E-value=0.63  Score=26.13  Aligned_cols=28  Identities=14%  Similarity=0.018  Sum_probs=21.6

Q ss_pred             ecccccccccccCCceeEEEcccccccc
Q 042525           33 SVPGAFYGALISQGIIASVNSSHSVRWL   60 (68)
Q Consensus        33 ~vpgSFy~rlfP~~Svh~~~Ss~alhWL   60 (68)
                      -+-+++..--+|++|+|.+++..++||+
T Consensus        46 ~~~~d~~~l~~~~~sfD~v~~~~~~~~~   73 (95)
T PF08241_consen   46 FRQGDAEDLPFPDNSFDVVFSNSVLHHL   73 (95)
T ss_dssp             EEESBTTSSSS-TT-EEEEEEESHGGGS
T ss_pred             heeehHHhCccccccccccccccceeec
Confidence            3445666668899999999999999998


No 4  
>KOG2940 consensus Predicted methyltransferase [General function prediction only]
Probab=85.96  E-value=0.22  Score=37.77  Aligned_cols=24  Identities=21%  Similarity=0.470  Sum_probs=21.9

Q ss_pred             ccCCceeEEEcccccccccCCCCC
Q 042525           43 ISQGIIASVNSSHSVRWLSSVPNE   66 (68)
Q Consensus        43 fP~~Svh~~~Ss~alhWLS~~P~~   66 (68)
                      |-++|+|+++||.++||....|..
T Consensus       133 f~ens~DLiisSlslHW~NdLPg~  156 (325)
T KOG2940|consen  133 FKENSVDLIISSLSLHWTNDLPGS  156 (325)
T ss_pred             ccccchhhhhhhhhhhhhccCchH
Confidence            778999999999999999999863


No 5  
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=68.87  E-value=3.3  Score=27.22  Aligned_cols=26  Identities=23%  Similarity=0.193  Sum_probs=19.2

Q ss_pred             cccCCceeEEE-------cc-cccccccCCCCCC
Q 042525           42 LISQGIIASVN-------SS-HSVRWLSSVPNEV   67 (68)
Q Consensus        42 lfP~~Svh~~~-------Ss-~alhWLS~~P~~l   67 (68)
                      +.|.+++-+.+       |+ +.++|+.|+|.++
T Consensus        10 v~p~~sv~LsC~~sg~~~s~e~~~~wvRq~pg~l   43 (115)
T cd05721          10 ASSNGAASLVCEYTYNGFSKEFRASLLKGADSAV   43 (115)
T ss_pred             EcCCCCEEEEEEecCCccccEEEEEEEEeCCCCc
Confidence            45666766655       34 8999999999864


No 6  
>KOG3010 consensus Methyltransferase [General function prediction only]
Probab=63.08  E-value=2.9  Score=31.22  Aligned_cols=17  Identities=12%  Similarity=0.560  Sum_probs=15.7

Q ss_pred             cCCceeEEEcccccccc
Q 042525           44 SQGIIASVNSSHSVRWL   60 (68)
Q Consensus        44 P~~Svh~~~Ss~alhWL   60 (68)
                      +++|||++.++-|+||.
T Consensus        97 ~e~SVDlI~~Aqa~HWF  113 (261)
T KOG3010|consen   97 GEESVDLITAAQAVHWF  113 (261)
T ss_pred             CCcceeeehhhhhHHhh
Confidence            48999999999999995


No 7  
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]
Probab=55.09  E-value=3.4  Score=29.93  Aligned_cols=32  Identities=13%  Similarity=0.181  Sum_probs=26.1

Q ss_pred             cccccccccCCceeEEEcccccccccCCCCCC
Q 042525           36 GAFYGALISQGIIASVNSSHSVRWLSSVPNEV   67 (68)
Q Consensus        36 gSFy~rlfP~~Svh~~~Ss~alhWLS~~P~~l   67 (68)
                      |..-+=-||++|.|.+..++.|+++.+.++.|
T Consensus       108 ~dAe~LPf~D~sFD~vt~~fglrnv~d~~~aL  139 (238)
T COG2226         108 GDAENLPFPDNSFDAVTISFGLRNVTDIDKAL  139 (238)
T ss_pred             echhhCCCCCCccCEEEeeehhhcCCCHHHHH
Confidence            45555569999999999999999998876543


No 8  
>PF13489 Methyltransf_23:  Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C ....
Probab=55.08  E-value=8.8  Score=23.59  Aligned_cols=22  Identities=9%  Similarity=0.164  Sum_probs=19.0

Q ss_pred             ccccCCceeEEEcccccccccC
Q 042525           41 ALISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        41 rlfP~~Svh~~~Ss~alhWLS~   62 (68)
                      ...|+++.|++++..+|||+..
T Consensus        72 ~~~~~~~fD~i~~~~~l~~~~d   93 (161)
T PF13489_consen   72 PPFPDGSFDLIICNDVLEHLPD   93 (161)
T ss_dssp             HHCHSSSEEEEEEESSGGGSSH
T ss_pred             hhccccchhhHhhHHHHhhccc
Confidence            3468899999999999999874


No 9  
>PRK05785 hypothetical protein; Provisional
Probab=53.23  E-value=4.1  Score=28.28  Aligned_cols=29  Identities=17%  Similarity=0.172  Sum_probs=21.8

Q ss_pred             cccccccccCCceeEEEcccccccccCCC
Q 042525           36 GAFYGALISQGIIASVNSSHSVRWLSSVP   64 (68)
Q Consensus        36 gSFy~rlfP~~Svh~~~Ss~alhWLS~~P   64 (68)
                      |++-.-=++++|.|.+++++++||+...+
T Consensus        99 ~d~~~lp~~d~sfD~v~~~~~l~~~~d~~  127 (226)
T PRK05785         99 GSFEALPFRDKSFDVVMSSFALHASDNIE  127 (226)
T ss_pred             echhhCCCCCCCEEEEEecChhhccCCHH
Confidence            34333346799999999999999976543


No 10 
>PRK10258 biotin biosynthesis protein BioC; Provisional
Probab=53.17  E-value=9.3  Score=26.18  Aligned_cols=21  Identities=14%  Similarity=0.284  Sum_probs=18.2

Q ss_pred             cccCCceeEEEcccccccccC
Q 042525           42 LISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        42 lfP~~Svh~~~Ss~alhWLS~   62 (68)
                      -++.++.|+++|..++||...
T Consensus        98 ~~~~~~fD~V~s~~~l~~~~d  118 (251)
T PRK10258         98 PLATATFDLAWSNLAVQWCGN  118 (251)
T ss_pred             cCCCCcEEEEEECchhhhcCC
Confidence            367889999999999999754


No 11 
>PRK14103 trans-aconitate 2-methyltransferase; Provisional
Probab=52.25  E-value=8.5  Score=26.63  Aligned_cols=26  Identities=15%  Similarity=0.276  Sum_probs=20.6

Q ss_pred             cccccccccCCceeEEEcccccccccC
Q 042525           36 GAFYGALISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        36 gSFy~rlfP~~Svh~~~Ss~alhWLS~   62 (68)
                      +.. ..+.+.++.|+++|..++||+..
T Consensus        79 ~d~-~~~~~~~~fD~v~~~~~l~~~~d  104 (255)
T PRK14103         79 GDV-RDWKPKPDTDVVVSNAALQWVPE  104 (255)
T ss_pred             cCh-hhCCCCCCceEEEEehhhhhCCC
Confidence            443 45667789999999999999864


No 12 
>PLN02232 ubiquinone biosynthesis methyltransferase
Probab=48.22  E-value=13  Score=24.29  Aligned_cols=27  Identities=11%  Similarity=0.060  Sum_probs=20.1

Q ss_pred             cccccccccCCceeEEEcccccccccC
Q 042525           36 GAFYGALISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        36 gSFy~rlfP~~Svh~~~Ss~alhWLS~   62 (68)
                      |...+=-+++++.|.+.+.+++||+..
T Consensus        33 ~d~~~lp~~~~~fD~v~~~~~l~~~~d   59 (160)
T PLN02232         33 GDAIDLPFDDCEFDAVTMGYGLRNVVD   59 (160)
T ss_pred             echhhCCCCCCCeeEEEecchhhcCCC
Confidence            343332367889999999999999754


No 13 
>PRK01683 trans-aconitate 2-methyltransferase; Provisional
Probab=47.01  E-value=13  Score=25.55  Aligned_cols=22  Identities=14%  Similarity=0.351  Sum_probs=18.5

Q ss_pred             ccccCCceeEEEcccccccccC
Q 042525           41 ALISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        41 rlfP~~Svh~~~Ss~alhWLS~   62 (68)
                      .+.|.++.|+++|..++||+..
T Consensus        87 ~~~~~~~fD~v~~~~~l~~~~d  108 (258)
T PRK01683         87 SWQPPQALDLIFANASLQWLPD  108 (258)
T ss_pred             ccCCCCCccEEEEccChhhCCC
Confidence            4457789999999999999854


No 14 
>TIGR02072 BioC biotin biosynthesis protein BioC. This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulfur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable). The enzyme appears related to methyltransferases by homology.
Probab=45.79  E-value=13  Score=24.33  Aligned_cols=27  Identities=11%  Similarity=0.224  Sum_probs=22.1

Q ss_pred             cccccccccCCceeEEEcccccccccC
Q 042525           36 GAFYGALISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        36 gSFy~rlfP~~Svh~~~Ss~alhWLS~   62 (68)
                      ++.-+..+++++.|++++..++||+..
T Consensus        87 ~d~~~~~~~~~~fD~vi~~~~l~~~~~  113 (240)
T TIGR02072        87 GDAEKLPLEDSSFDLIVSNLALQWCDD  113 (240)
T ss_pred             cchhhCCCCCCceeEEEEhhhhhhccC
Confidence            455566678899999999999999854


No 15 
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only]
Probab=41.35  E-value=15  Score=27.67  Aligned_cols=22  Identities=27%  Similarity=0.478  Sum_probs=19.2

Q ss_pred             cccCCceeEEEcccccccccCC
Q 042525           42 LISQGIIASVNSSHSVRWLSSV   63 (68)
Q Consensus        42 lfP~~Svh~~~Ss~alhWLS~~   63 (68)
                      =|++++.|=++|-.|++||=.+
T Consensus       107 pfrpGtFDg~ISISAvQWLcnA  128 (270)
T KOG1541|consen  107 PFRPGTFDGVISISAVQWLCNA  128 (270)
T ss_pred             CCCCCccceEEEeeeeeeeccc
Confidence            3789999999999999999654


No 16 
>TIGR02727 MTHFS_bact 5,10-methenyltetrahydrofolate synthetase. This enzyme, 5,10-methenyltetrahydrofolate synthetase, is also called 5-formyltetrahydrofolate cycloligase. Function of bacterial proteins in this family was inferred originally from the known activity of eukaryotic homologs. Recently, activity was shown explicitly for the member from Mycoplasma pneumonia. Members of this family from alpha- and gamma-proteobacteria, designated ygfA, are often found in an operon with 6S structural RNA, and show a similar pattern of high expression during stationary phase. The function may be to deplete folate to slow 1-carbon biosynthetic metabolism.
Probab=39.50  E-value=13  Score=24.84  Aligned_cols=38  Identities=11%  Similarity=0.203  Sum_probs=24.4

Q ss_pred             cceEEecccccccccccCCcee---EEEcccccccccCCCCC
Q 042525           28 NYFAASVPGAFYGALISQGIIA---SVNSSHSVRWLSSVPNE   66 (68)
Q Consensus        28 ~~f~~~vpgSFy~rlfP~~Svh---~~~Ss~alhWLS~~P~~   66 (68)
                      +-+=.|.||.||+|.+..-.-.   +|. ++..+.+.++|.+
T Consensus       129 ~G~RLG~GgGyYDR~L~~~~~~~~~igv-~~~~q~~~~lp~e  169 (181)
T TIGR02727       129 RGYRLGYGGGYYDRFLANLKGKTVVVGL-AFDFQLVDELPRE  169 (181)
T ss_pred             CCccccCCcchHHHHHHhcccCCCEEEE-EecceeeCccCCC
Confidence            4456789999999998753211   333 3566666666643


No 17 
>TIGR03488 cas_Cas5p CRISPR-associated protein, Cas5p family. CC Members of this protein family are cas, or CRISPR-associated, proteins. The two sequences in the alignment seed are found within cas gene clusters that are adjacent to CRISPR DNA repeats in two members of the order Bacteroidales, Porphyromonas gingivalis W83 and Bacteroides forsythus ATCC 43037. This cas protein family is unique to the Pgingi (Porphyromonas gingivalis) subtype, but shows some sequence similarity to genes of the Cas5 type (see TIGR02593).
Probab=39.29  E-value=5  Score=29.22  Aligned_cols=30  Identities=27%  Similarity=0.566  Sum_probs=20.0

Q ss_pred             eEEecccccccc-cccCCceeEEEccccccc
Q 042525           30 FAASVPGAFYGA-LISQGIIASVNSSHSVRW   59 (68)
Q Consensus        30 f~~~vpgSFy~r-lfP~~Svh~~~Ss~alhW   59 (68)
                      .++-.|||||.. ++|++-+=-|.--+.|.|
T Consensus        28 mvselpgsfykal~~p~k~iicgl~envlgw   58 (237)
T TIGR03488        28 MVSELPGSFYKALLVPDKHIICGLFENVLGW   58 (237)
T ss_pred             HHHhCchhHHHHhcCCcchhhhhhhhhhhhc
Confidence            567799999987 567776544444444444


No 18 
>PLN02233 ubiquinone biosynthesis methyltransferase
Probab=39.02  E-value=22  Score=25.12  Aligned_cols=20  Identities=5%  Similarity=0.111  Sum_probs=17.7

Q ss_pred             ccCCceeEEEcccccccccC
Q 042525           43 ISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        43 fP~~Svh~~~Ss~alhWLS~   62 (68)
                      +|+++.|.+++++++||+..
T Consensus       141 ~~~~sfD~V~~~~~l~~~~d  160 (261)
T PLN02233        141 FDDCYFDAITMGYGLRNVVD  160 (261)
T ss_pred             CCCCCEeEEEEecccccCCC
Confidence            67899999999999999753


No 19 
>PF08436 DXP_redisom_C:  1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal;  InterPro: IPR013644 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms []. In Arabidopsis thaliana 1-deoxy-D-xylulose 5-phosphate reductoisomerase is the first committed enzyme of the non-mevalonate pathway for isoprenoid biosynthesis. The enzyme requires Mn2+, Co2+ or Mg2+ for activity, with the first being most effective. This domain is found to the C terminus of IPR013512 from INTERPRO domains in bacterial and plant 1-deoxy-D-xylulose 5-phosphate reductoisomerases.; GO: 0005515 protein binding; PDB: 3AUA_A 3AU9_B 3AU8_B 3A14_A 3A06_A 2Y1D_B 4AIC_A 2JD0_B 2Y1C_B 2JD1_A ....
Probab=38.31  E-value=12  Score=23.68  Aligned_cols=26  Identities=19%  Similarity=0.383  Sum_probs=19.4

Q ss_pred             HHHHhhcCCCC-----ccceEEecccccccc
Q 042525           16 FNTLFKSLPPE-----RNYFAASVPGAFYGA   41 (68)
Q Consensus        16 Fn~lF~~l~~~-----~~~f~~~vpgSFy~r   41 (68)
                      -|.+|+.|...     ++++..|.||-|+++
T Consensus         8 HsAifQ~L~~~~~~~v~~i~lTASGGpFr~~   38 (84)
T PF08436_consen    8 HSAIFQCLQGEKREEVEKIILTASGGPFRDK   38 (84)
T ss_dssp             HHHHHHHSGHHHHCTEEEEEEEE--STTTTS
T ss_pred             HHHHHHHCCCCCccccCEEEEECcchhhCCC
Confidence            47899999754     478999999999875


No 20 
>PRK10333 5-formyltetrahydrofolate cyclo-ligase family protein; Provisional
Probab=37.76  E-value=15  Score=24.92  Aligned_cols=38  Identities=16%  Similarity=0.199  Sum_probs=25.5

Q ss_pred             cceEEecccccccccccCCc----eeEEEcccccccccCCCCC
Q 042525           28 NYFAASVPGAFYGALISQGI----IASVNSSHSVRWLSSVPNE   66 (68)
Q Consensus        28 ~~f~~~vpgSFy~rlfP~~S----vh~~~Ss~alhWLS~~P~~   66 (68)
                      +-+=.|.||.||+|.++.-+    .-+|. ++..+.+.++|.+
T Consensus       123 ~G~RLG~GgGyYDR~L~~~~~~~~~~igl-a~~~Q~~~~ip~e  164 (182)
T PRK10333        123 YGQRLGMGGGFYDRTLQNWQHYKTQPVGY-AHDCQLVEKLPVE  164 (182)
T ss_pred             CCCcccCCcchHHHHHHHhcccCCcEEEE-eeeeEEeCCcCCC
Confidence            44667899999999998522    22444 4556667777753


No 21 
>PF08242 Methyltransf_12:  Methyltransferase domain;  InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalyzed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. This entry represents a methyltransferase domain found in a large variety of SAM-dependent methyltransferases including, but not limited to:  Hexaprenyldihydroxybenzoate methyltransferase (2.1.1.114 from EC), a mitochodrial enzyme involved in ubiquinone biosynthesis [] Fatty acid synthase (2.3.1.85 from EC), a biosynthetic enzyme catalysing the formation of long-chain fatty acids Glycine N-methyltransferase (2.1.1.20 from EC) which catalyses the SAM-dependent methylation of glycine to form sarcosine and may play a role in regulating the methylation potential of the cell [] Enniatin synthetase, involved in non-ribosomal biosynthesis of cyclohexadepsipeptidase, enniatin [] Histamine N-methyltransferase (2.1.1.8 from EC), a SAM-dependent histamine-inactivating enzyme []  A probable cobalt-precorrin-6Y C(15)-methyltransferase thought to be involved in adenosylcobalamin biosynthesis []  Structural studies show that this domain forms the Rossman-like alpha-beta fold typical of SAM-dependent methyltransferases [, , ].; PDB: 2VZ8_A 2VZ9_A.
Probab=37.71  E-value=17  Score=21.11  Aligned_cols=16  Identities=19%  Similarity=0.138  Sum_probs=9.3

Q ss_pred             CceeEEEccccccccc
Q 042525           46 GIIASVNSSHSVRWLS   61 (68)
Q Consensus        46 ~Svh~~~Ss~alhWLS   61 (68)
                      ++.|+++++.++||+.
T Consensus        65 ~~fD~V~~~~vl~~l~   80 (99)
T PF08242_consen   65 ESFDLVVASNVLHHLE   80 (99)
T ss_dssp             ---SEEEEE-TTS--S
T ss_pred             cccceehhhhhHhhhh
Confidence            7999999999999993


No 22 
>PRK06202 hypothetical protein; Provisional
Probab=36.77  E-value=20  Score=24.40  Aligned_cols=19  Identities=21%  Similarity=0.221  Sum_probs=17.0

Q ss_pred             cCCceeEEEcccccccccC
Q 042525           44 SQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        44 P~~Svh~~~Ss~alhWLS~   62 (68)
                      ++++.|+++++.++||+..
T Consensus       126 ~~~~fD~V~~~~~lhh~~d  144 (232)
T PRK06202        126 EGERFDVVTSNHFLHHLDD  144 (232)
T ss_pred             cCCCccEEEECCeeecCCh
Confidence            6789999999999999864


No 23 
>TIGR02081 metW methionine biosynthesis protein MetW. This protein is found alongside MetX, of the enzyme that acylates homoserine as a first step toward methionine biosynthesis, in many species. It appears to act in methionine biosynthesis but is not fully characterized.
Probab=34.43  E-value=22  Score=23.54  Aligned_cols=20  Identities=10%  Similarity=0.014  Sum_probs=17.6

Q ss_pred             ccCCceeEEEcccccccccC
Q 042525           43 ISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        43 fP~~Svh~~~Ss~alhWLS~   62 (68)
                      +++++.|++++..++||+..
T Consensus        71 ~~~~sfD~Vi~~~~l~~~~d   90 (194)
T TIGR02081        71 FPDKSFDYVILSQTLQATRN   90 (194)
T ss_pred             cCCCCcCEEEEhhHhHcCcC
Confidence            57889999999999999854


No 24 
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase. MenG is a generic term for a methyltransferase that catalyzes the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species.
Probab=31.06  E-value=46  Score=22.27  Aligned_cols=29  Identities=14%  Similarity=0.117  Sum_probs=21.1

Q ss_pred             cccccccccccCCceeEEEcccccccccC
Q 042525           34 VPGAFYGALISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        34 vpgSFy~rlfP~~Svh~~~Ss~alhWLS~   62 (68)
                      +.|...+--+|.++.|++++..++||++.
T Consensus       101 ~~~d~~~~~~~~~~fD~V~~~~~l~~~~~  129 (231)
T TIGR02752       101 VHGNAMELPFDDNSFDYVTIGFGLRNVPD  129 (231)
T ss_pred             EEechhcCCCCCCCccEEEEecccccCCC
Confidence            33444443467889999999999999754


No 25 
>TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of this protein family are 6-phospho 3-hexuloisomerase (PHI), or the PHI domain of a fusion protein. This enzyme is part of the ribulose monophosphate (RuMP) pathway, which in one direction removes the toxic metabolite formaldehyde by assimilation into fructose-6-phosphate. In the other direction, in species lacking a complete pentose phosphate pathway, the RuMP pathway yields ribulose-5-phosphate, necessary for nucleotide biosynthesis, at the cost of also yielding formaldehyde. These latter species tend usually have a formaldehyde-activating enzyme to attach formaldehyde to the C1 carrier tetrahydromethanopterin.
Probab=28.53  E-value=19  Score=23.56  Aligned_cols=29  Identities=10%  Similarity=0.156  Sum_probs=21.3

Q ss_pred             CCCCcHHHHhhcCCCCccceEEecccccc
Q 042525           11 HTSNDFNTLFKSLPPERNYFAASVPGAFY   39 (68)
Q Consensus        11 lP~NDFn~lF~~l~~~~~~f~~~vpgSFy   39 (68)
                      +..+++..+.+.+...+++|+.|+++|.+
T Consensus        15 l~~~~~~~~~~~l~~a~~I~i~G~G~S~~   43 (179)
T TIGR03127        15 IDEEELDKLADKIIKAKRIFVAGAGRSGL   43 (179)
T ss_pred             CCHHHHHHHHHHHHhCCEEEEEecCHHHH
Confidence            34456666666776667899999999864


No 26 
>PF06441 EHN:  Epoxide hydrolase N terminus;  InterPro: IPR010497 This entry represents the N-terminal region of the eukaryotic epoxide hydrolase protein. Epoxide hydrolases (3.3.2.3 from EC) comprise a group of functionally related enzymes that catalyse the addition of water to oxirane compounds (epoxides), thereby usually generating vicinal trans-diols. EHs have been found in all types of living organisms, including mammals, invertebrates, plants, fungi and bacteria. In animals, the major interest in EH is directed towards their detoxification capacity for epoxides since they are important safeguards against the cytotoxic and genotoxic potential of oxirane derivatives that are often reactive electrophiles because of the high tension of the three-membered ring system and the strong polarisation of the C--O bonds. This is of significant relevance because epoxides are frequent intermediary metabolites, which arise during the biotransformation of foreign compounds []. This domain is often found in conjunction with IPR000073 from INTERPRO.; GO: 0004301 epoxide hydrolase activity, 0009636 response to toxin, 0016020 membrane; PDB: 3G0I_B 3G02_A 1QO7_A.
Probab=25.63  E-value=35  Score=21.85  Aligned_cols=12  Identities=25%  Similarity=0.537  Sum_probs=6.7

Q ss_pred             ceEEeccccccc
Q 042525           29 YFAASVPGAFYG   40 (68)
Q Consensus        29 ~f~~~vpgSFy~   40 (68)
                      ++.-|-||||++
T Consensus        96 ll~HGWPgSf~E  107 (112)
T PF06441_consen   96 LLLHGWPGSFLE  107 (112)
T ss_dssp             EEE--SS--GGG
T ss_pred             EEECCCCccHHh
Confidence            678899999986


No 27 
>PF01209 Ubie_methyltran:  ubiE/COQ5 methyltransferase family;  InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []. Apart from the ubiquinone/menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the ubiE gene of Escherichia coli), the ubiquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the COQ5 gene of Saccharomyces cerevisiae) and the menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the MENH gene of Bacillus subtilis), this family also includes methyltransferases involved in biotin and sterol biosynthesis and in phosphatidylethanolamine methylation.; GO: 0008168 methyltransferase activity; PDB: 1VL5_C.
Probab=24.41  E-value=60  Score=22.86  Aligned_cols=27  Identities=15%  Similarity=0.161  Sum_probs=16.2

Q ss_pred             cccccccccCCceeEEEcccccccccC
Q 042525           36 GAFYGALISQGIIASVNSSHSVRWLSS   62 (68)
Q Consensus        36 gSFy~rlfP~~Svh~~~Ss~alhWLS~   62 (68)
                      |+.-.==+|++|.|.+.+++++|-+..
T Consensus       105 ~da~~lp~~d~sfD~v~~~fglrn~~d  131 (233)
T PF01209_consen  105 GDAEDLPFPDNSFDAVTCSFGLRNFPD  131 (233)
T ss_dssp             -BTTB--S-TT-EEEEEEES-GGG-SS
T ss_pred             cCHHHhcCCCCceeEEEHHhhHHhhCC
Confidence            444443489999999999999998754


No 28 
>cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI is a member of the SIS (Sugar ISomerase domain) superfamily. In the ribulose monophosphate pathway of formaldehyde fixation, hexulose-6-phosphate synthase catalyzes the condensation of ribulose-5-phosphate with formadelhyde to become hexulose-6-phosphate, which is then isomerized to fructose-6-phosphate by PHI.
Probab=23.95  E-value=20  Score=23.54  Aligned_cols=29  Identities=7%  Similarity=0.148  Sum_probs=20.2

Q ss_pred             CCCCcHHHHhhcCCCCccceEEecccccc
Q 042525           11 HTSNDFNTLFKSLPPERNYFAASVPGAFY   39 (68)
Q Consensus        11 lP~NDFn~lF~~l~~~~~~f~~~vpgSFy   39 (68)
                      +...+...+.+.+...+++|+.|+++|.+
T Consensus        18 l~~~~l~~~~~~i~~a~~I~i~G~G~S~~   46 (179)
T cd05005          18 IDEEELDKLISAILNAKRIFVYGAGRSGL   46 (179)
T ss_pred             cCHHHHHHHHHHHHhCCeEEEEecChhHH
Confidence            33445556666665667899999998865


No 29 
>PRK10886 DnaA initiator-associating protein DiaA; Provisional
Probab=21.90  E-value=45  Score=23.16  Aligned_cols=15  Identities=7%  Similarity=0.002  Sum_probs=12.3

Q ss_pred             CCCCccceEEecccc
Q 042525           23 LPPERNYFAASVPGA   37 (68)
Q Consensus        23 l~~~~~~f~~~vpgS   37 (68)
                      +...+++|++|+|||
T Consensus        38 l~~~~rI~~~G~GgS   52 (196)
T PRK10886         38 LLNGNKILCCGNGTS   52 (196)
T ss_pred             HHcCCEEEEEECcHH
Confidence            344578999999999


No 30 
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism]
Probab=20.85  E-value=66  Score=25.41  Aligned_cols=27  Identities=22%  Similarity=0.466  Sum_probs=22.3

Q ss_pred             cHHHHhhcCCCC-----ccceEEecccccccc
Q 042525           15 DFNTLFKSLPPE-----RNYFAASVPGAFYGA   41 (68)
Q Consensus        15 DFn~lF~~l~~~-----~~~f~~~vpgSFy~r   41 (68)
                      .-|.+|+.|+..     .++...|.||.|++.
T Consensus       148 EH~AifQ~L~~~~~~~v~~iiLTASGGpFR~~  179 (385)
T COG0743         148 EHNAIFQCLQGETQKGVKKIILTASGGPFRDK  179 (385)
T ss_pred             hhHHHHHHcCccccCcceEEEEecCCCCcCCC
Confidence            468999999865     368999999999874


No 31 
>PF01812 5-FTHF_cyc-lig:  5-formyltetrahydrofolate cyclo-ligase family;  InterPro: IPR002698 5-formyltetrahydrofolate cyclo-ligase or methenyl-THF synthetase 6.3.3.2 from EC catalyses the interchange of 5-formyltetrahydrofolate (5-FTHF) to 5-10-methenyltetrahydrofolate, this requires ATP and Mg2+ []. 5-FTHF is used in chemotherapy where it is clinically known as Leucovorin [].; GO: 0005524 ATP binding, 0030272 5-formyltetrahydrofolate cyclo-ligase activity, 0009396 folic acid-containing compound biosynthetic process; PDB: 1WKC_A 1SBQ_A 1U3G_A 1U3F_B 1YDM_B 1SOU_A 2JCB_B 3HY6_A 3HY4_A 3HXT_A ....
Probab=20.20  E-value=27  Score=23.13  Aligned_cols=38  Identities=11%  Similarity=0.202  Sum_probs=19.5

Q ss_pred             cceEEecccccccccccCCce-----eEEEcccccccccCCCC
Q 042525           28 NYFAASVPGAFYGALISQGII-----ASVNSSHSVRWLSSVPN   65 (68)
Q Consensus        28 ~~f~~~vpgSFy~rlfP~~Sv-----h~~~Ss~alhWLS~~P~   65 (68)
                      +-+=.|-||-||+|.+..-.-     -.+--++..+.+.++|.
T Consensus       131 ~G~RLG~GgGyYDR~L~~~~~~~~~~~~igl~~~~q~~~~iP~  173 (186)
T PF01812_consen  131 NGNRLGYGGGYYDRFLARLPPGRKKPLKIGLAFDFQIVDDIPV  173 (186)
T ss_dssp             TSBEE-SSSTHHHHHHHHHTS-SS--EEEEEE-GGGEES----
T ss_pred             CCCeEecCCCHHHhHHHhhhcccCCCeEEEEeehhheeCCCCC
Confidence            445678899999998764432     22223345556666664


Done!