BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042529
         (456 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3AQB|B Chain B, M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphosphate
           Synthase In Complex With Magnesium
 pdb|3AQB|D Chain D, M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphosphate
           Synthase In Complex With Magnesium
 pdb|3AQC|B Chain B, M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphosphate
           Synthase In Complex With Magnesium And Fpp Analogue
 pdb|3AQC|D Chain D, M. Luteus B-P 26 Heterodimeric Hexaprenyl Diphosphate
           Synthase In Complex With Magnesium And Fpp Analogue
          Length = 325

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 15/106 (14%)

Query: 282 GEF-----RFRHP--WKQYLKIGSLTRNCAYRIEALN--GYLNTETKIPEEIRGKMQDAC 332
           GEF     RF +P  +  YL+   + R  A  IEA    G L+++         K    C
Sbjct: 145 GEFDQMADRFNYPVSFTAYLR--RINRKTAILIEASCHLGALSSQLDEQSTYHIKQFGHC 202

Query: 333 INMSYEAVKALKELAFSIQTMTKPCSA---NSHITKSKIAA-KNLK 374
           I MSY+ +  + +      T+ KP  +   N HIT   +AA  NLK
Sbjct: 203 IGMSYQIIDDILDYTSDEATLGKPVGSDIRNGHITYPLMAAIANLK 248


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.137    0.413 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,165,005
Number of Sequences: 62578
Number of extensions: 403591
Number of successful extensions: 673
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 673
Number of HSP's gapped (non-prelim): 1
length of query: 456
length of database: 14,973,337
effective HSP length: 102
effective length of query: 354
effective length of database: 8,590,381
effective search space: 3040994874
effective search space used: 3040994874
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (25.0 bits)