BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 042655
(392 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3PRL|A Chain A, Crystal Structure Of Nadp-Dependent
Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus
Halodurans C-125
pdb|3PRL|B Chain B, Crystal Structure Of Nadp-Dependent
Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus
Halodurans C-125
pdb|3PRL|C Chain C, Crystal Structure Of Nadp-Dependent
Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus
Halodurans C-125
pdb|3PRL|D Chain D, Crystal Structure Of Nadp-Dependent
Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus
Halodurans C-125
pdb|3RHH|A Chain A, Crystal Structure Of Nadp-Dependent
Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus
Halodurans C-125 Complexed With Nadp
pdb|3RHH|B Chain B, Crystal Structure Of Nadp-Dependent
Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus
Halodurans C-125 Complexed With Nadp
pdb|3RHH|C Chain C, Crystal Structure Of Nadp-Dependent
Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus
Halodurans C-125 Complexed With Nadp
pdb|3RHH|D Chain D, Crystal Structure Of Nadp-Dependent
Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus
Halodurans C-125 Complexed With Nadp
Length = 505
Score = 30.0 bits (66), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 18/92 (19%)
Query: 205 IIPVADGDHVKLHMSKKAEKDFALKLLVLSQNIKRAVDVHEHL--------AQSIRRPAE 256
II V D + +S + D+ L+ + +++ RA+++ +HL A++ R P
Sbjct: 394 IIRVKDANEA---ISLSNQSDYGLQASIFTKDTDRAINIGKHLEVGTVHINAKTERGPDH 450
Query: 257 LMMGSFDGIKALQEQYGLGQQGMKILLATLSR 288
F G+K + GLG QG+K L +++R
Sbjct: 451 F---PFLGVK----KSGLGVQGIKPSLLSMTR 475
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.138 0.398
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,312,323
Number of Sequences: 62578
Number of extensions: 389568
Number of successful extensions: 889
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 887
Number of HSP's gapped (non-prelim): 3
length of query: 392
length of database: 14,973,337
effective HSP length: 101
effective length of query: 291
effective length of database: 8,652,959
effective search space: 2518011069
effective search space used: 2518011069
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)