Query         042693
Match_columns 71
No_of_seqs    100 out of 360
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 08:33:22 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042693.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042693hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 CHL00117 rpoC2 RNA polymerase   99.9   6E-27 1.3E-31  199.2   6.9   69    2-71   1073-1154(1364)
  2 TIGR02388 rpoC2_cyan DNA-direc  99.9 3.9E-25 8.6E-30  186.9   7.0   65    1-65    917-994 (1227)
  3 PRK02597 rpoC2 DNA-directed RN  99.9 2.6E-24 5.7E-29  182.9   5.1   65    1-65    919-996 (1331)
  4 PRK14844 bifunctional DNA-dire  99.6 3.4E-16 7.3E-21  139.7   2.7   52   15-66   2520-2571(2836)
  5 PRK09603 bifunctional DNA-dire  99.6 1.4E-15   3E-20  136.0   4.8   59    7-65   2602-2662(2890)
  6 TIGR02386 rpoC_TIGR DNA-direct  98.3 1.5E-07 3.2E-12   80.8   1.5   21   46-66    904-924 (1140)
  7 cd00630 RNAP_largest_subunit_C  98.3 6.3E-08 1.4E-12   67.2  -1.9   35   34-68     20-54  (158)
  8 PRK14906 DNA-directed RNA poly  98.3 2.8E-07 6.1E-12   80.6   1.6   25   42-66   1001-1025(1460)
  9 PRK00566 DNA-directed RNA poly  98.1 8.2E-07 1.8E-11   76.4   1.3   41   26-66    873-927 (1156)
 10 cd02655 RNAP_beta'_C Largest s  97.5 3.6E-05 7.8E-10   55.5   1.3   19   46-64     36-54  (204)
 11 PF13533 Biotin_lipoyl_2:  Biot  96.3  0.0048   1E-07   34.8   2.7   25   20-44     15-39  (50)
 12 TIGR02971 heterocyst_DevB ABC   94.9   0.044 9.5E-07   39.7   4.0   35    7-41     10-50  (327)
 13 PF00529 HlyD:  HlyD family sec  94.6   0.036 7.7E-07   38.8   2.9   22   21-42     15-36  (305)
 14 cd02736 RNAP_III_Rpc1_C Larges  94.4   0.023 5.1E-07   42.9   1.7   32   33-64     28-59  (300)
 15 cd06528 RNAP_A'' A'' subunit o  94.4   0.019 4.1E-07   44.4   1.2   32   33-64     58-89  (363)
 16 PF04998 RNA_pol_Rpb1_5:  RNA p  94.3   0.011 2.3E-07   41.1  -0.3   30   37-66     93-122 (277)
 17 TIGR02389 RNA_pol_rpoA2 DNA-di  94.3   0.024 5.2E-07   44.0   1.5   32   33-64     62-93  (367)
 18 PRK04309 DNA-directed RNA poly  94.2   0.026 5.7E-07   43.9   1.6   32   33-64     77-108 (383)
 19 PRK14897 unknown domain/DNA-di  93.4   0.039 8.4E-07   44.8   1.4   32   33-64    200-231 (509)
 20 cd02584 RNAP_II_Rpb1_C Largest  93.1   0.041   9E-07   43.2   1.1   31   34-64     46-76  (410)
 21 PF07831 PYNP_C:  Pyrimidine nu  93.1   0.075 1.6E-06   32.6   2.0   29   15-43     30-58  (75)
 22 TIGR01000 bacteriocin_acc bact  93.0    0.18 3.8E-06   38.9   4.4   33   10-42     59-94  (457)
 23 TIGR00998 8a0101 efflux pump m  92.4    0.22 4.8E-06   35.8   4.0   32   12-43     44-78  (334)
 24 TIGR03794 NHPM_micro_HlyD NHPM  92.0    0.26 5.7E-06   37.3   4.2   38    7-44     55-95  (421)
 25 TIGR00830 PTBA PTS system, glu  92.0    0.31 6.7E-06   32.6   4.0   30   17-46     80-109 (121)
 26 cd00210 PTS_IIA_glc PTS_IIA, P  91.9    0.33 7.1E-06   32.5   4.1   31   17-47     80-110 (124)
 27 TIGR02645 ARCH_P_rylase putati  91.2    0.39 8.4E-06   38.9   4.5   39    4-42    418-472 (493)
 28 TIGR03327 AMP_phos AMP phospho  90.9    0.39 8.4E-06   39.0   4.2   39    4-42    419-473 (500)
 29 PRK10559 p-hydroxybenzoic acid  90.9    0.33 7.2E-06   35.8   3.6   34    9-42     46-82  (310)
 30 TIGR02644 Y_phosphoryl pyrimid  90.9    0.37   8E-06   38.0   4.0   39    4-42    338-399 (405)
 31 cd06850 biotinyl_domain The bi  90.9    0.51 1.1E-05   26.0   3.6   19   21-39     13-31  (67)
 32 PRK04350 thymidine phosphoryla  90.8    0.44 9.6E-06   38.5   4.5   39    4-42    410-464 (490)
 33 PRK14898 DNA-directed RNA poly  90.8    0.25 5.5E-06   41.8   3.2   46   17-64    528-574 (858)
 34 PRK15136 multidrug efflux syst  90.7    0.39 8.5E-06   36.5   3.9   33    9-41     60-95  (390)
 35 PRK09439 PTS system glucose-sp  90.7    0.48   1E-05   33.3   4.1   30   17-46    102-131 (169)
 36 PRK05820 deoA thymidine phosph  90.4    0.42 9.1E-06   38.1   4.0   39    4-42    345-406 (440)
 37 TIGR02643 T_phosphoryl thymidi  90.2    0.46   1E-05   37.9   4.1   39    4-42    344-405 (437)
 38 COG0511 AccB Biotin carboxyl c  90.1    0.71 1.5E-05   31.0   4.4   17   22-38    122-138 (140)
 39 PRK03598 putative efflux pump   90.0    0.49 1.1E-05   34.5   3.8   21   21-41     57-77  (331)
 40 PRK05889 putative acetyl-CoA c  90.0     1.1 2.3E-05   26.3   4.6   20   22-41     17-36  (71)
 41 PF00358 PTS_EIIA_1:  phosphoen  89.1    0.28 6.1E-06   33.1   1.9   30   17-46     84-113 (132)
 42 COG2190 NagE Phosphotransferas  88.9    0.77 1.7E-05   32.2   4.0   29   18-46     88-116 (156)
 43 TIGR01843 type_I_hlyD type I s  88.9    0.72 1.6E-05   33.8   4.0   24   21-44     57-80  (423)
 44 CHL00117 rpoC2 RNA polymerase   88.8     0.8 1.7E-05   41.1   4.9   27   15-41    400-426 (1364)
 45 cd02735 RNAP_I_Rpa1_C Largest   87.9    0.27   6E-06   37.2   1.3   32   33-64     28-60  (309)
 46 PRK10476 multidrug resistance   87.7    0.52 1.1E-05   34.7   2.6   29   15-43     53-84  (346)
 47 PF06898 YqfD:  Putative stage   87.4     1.1 2.3E-05   34.4   4.3   36    4-40    194-229 (385)
 48 PF01333 Apocytochr_F_C:  Apocy  87.1    0.29 6.3E-06   33.3   0.9   25   15-39     40-64  (118)
 49 PRK06549 acetyl-CoA carboxylas  87.1     1.7 3.8E-05   29.3   4.7   20   22-41     76-95  (130)
 50 PRK06078 pyrimidine-nucleoside  86.5     1.2 2.5E-05   35.6   4.1   36    4-39    340-398 (434)
 51 PRK05889 putative acetyl-CoA c  86.0     1.3 2.8E-05   26.0   3.2   35    4-38      7-70  (71)
 52 TIGR02876 spore_yqfD sporulati  85.7     1.5 3.3E-05   33.8   4.3   34    4-38    191-224 (382)
 53 PRK08225 acetyl-CoA carboxylas  85.5     1.2 2.6E-05   25.8   2.9   18   21-38     52-69  (70)
 54 PF12700 HlyD_2:  HlyD family s  85.1    0.73 1.6E-05   32.5   2.2   24   20-43     33-56  (328)
 55 TIGR01730 RND_mfp RND family e  84.2    0.96 2.1E-05   31.8   2.5   28   15-42     31-61  (322)
 56 PF00364 Biotin_lipoyl:  Biotin  83.6    0.74 1.6E-05   27.3   1.5   24   20-43     19-42  (74)
 57 PRK05641 putative acetyl-CoA c  83.3     2.9 6.2E-05   28.8   4.4   21   22-42     99-119 (153)
 58 PRK14977 bifunctional DNA-dire  83.1    0.55 1.2E-05   41.8   1.0   31   34-64    997-1027(1321)
 59 PRK08225 acetyl-CoA carboxylas  82.9     1.6 3.5E-05   25.3   2.7   22   21-42     15-36  (70)
 60 PF00364 Biotin_lipoyl:  Biotin  82.8     2.6 5.7E-05   24.9   3.6   24   15-38     48-74  (74)
 61 PRK11578 macrolide transporter  82.6     1.3 2.8E-05   32.9   2.7   21   21-41     75-95  (370)
 62 PRK11556 multidrug efflux syst  82.4     1.2 2.7E-05   34.1   2.6   20   21-40    101-120 (415)
 63 COG0845 AcrA Membrane-fusion p  82.4     1.3 2.8E-05   30.6   2.5   21   20-40     79-99  (372)
 64 PRK09824 PTS system beta-gluco  82.2     2.1 4.5E-05   35.5   3.9   30   17-46    560-589 (627)
 65 PRK07051 hypothetical protein;  82.2     1.7 3.6E-05   26.2   2.7   18   21-38     61-78  (80)
 66 TIGR01995 PTS-II-ABC-beta PTS   81.7     2.3   5E-05   34.8   4.1   30   17-46    544-573 (610)
 67 PRK09578 periplasmic multidrug  81.6     1.3 2.8E-05   33.2   2.4   22   21-42     77-98  (385)
 68 PRK14844 bifunctional DNA-dire  81.2     2.7 5.8E-05   40.5   4.6   40   15-54   2418-2467(2836)
 69 PRK09859 multidrug efflux syst  80.4     1.5 3.3E-05   32.8   2.4   21   21-41     75-95  (385)
 70 COG0213 DeoA Thymidine phospho  80.4     2.9 6.3E-05   33.7   4.1   25   17-41    377-401 (435)
 71 PRK10255 PTS system N-acetyl g  80.4     2.6 5.6E-05   35.1   3.9   30   17-46    580-609 (648)
 72 PRK06748 hypothetical protein;  80.3     2.3 4.9E-05   26.8   2.9   20   21-40     18-37  (83)
 73 COG0511 AccB Biotin carboxyl c  80.3     1.9 4.1E-05   28.9   2.7   19   21-39     84-102 (140)
 74 CHL00037 petA cytochrome f      79.2     3.2 6.9E-05   32.3   3.9   25   15-39    242-266 (320)
 75 PRK15030 multidrug efflux syst  78.8     1.8 3.9E-05   32.7   2.4   21   21-41     79-99  (397)
 76 PRK02693 apocytochrome f; Revi  78.1     3.6 7.8E-05   31.9   3.9   25   15-39    234-258 (312)
 77 PRK02597 rpoC2 DNA-directed RN  77.5     4.9 0.00011   36.3   5.0   32   10-41    394-425 (1331)
 78 TIGR00531 BCCP acetyl-CoA carb  77.5     2.1 4.5E-05   29.3   2.2   28   16-43     96-123 (156)
 79 PRK06302 acetyl-CoA carboxylas  76.8     2.1 4.6E-05   29.2   2.1   29   15-43     94-122 (155)
 80 PF02749 QRPTase_N:  Quinolinat  76.6     2.1 4.5E-05   26.3   1.9   21   19-39     47-67  (88)
 81 COG1566 EmrA Multidrug resista  75.9     2.9 6.2E-05   32.4   2.8   21   20-40     66-86  (352)
 82 PRK07051 hypothetical protein;  74.3       4 8.8E-05   24.5   2.7   25   18-42     21-45  (80)
 83 KOG0261 RNA polymerase III, la  73.2     2.4 5.2E-05   37.9   2.0   32   33-64   1045-1076(1386)
 84 TIGR00531 BCCP acetyl-CoA carb  72.9      11 0.00024   25.7   4.8   18   21-38    138-155 (156)
 85 PRK06549 acetyl-CoA carboxylas  72.3     4.3 9.3E-05   27.4   2.7   35    4-38     66-129 (130)
 86 PF13437 HlyD_3:  HlyD family s  71.9     6.3 0.00014   23.8   3.2   29    4-40      4-32  (105)
 87 PRK06748 hypothetical protein;  70.1     6.8 0.00015   24.6   3.1   31   15-45     47-80  (83)
 88 TIGR02386 rpoC_TIGR DNA-direct  70.0     7.7 0.00017   34.6   4.3   34   15-61    962-995 (1140)
 89 TIGR02388 rpoC2_cyan DNA-direc  69.0      11 0.00023   34.1   5.0   30   12-41    396-425 (1227)
 90 PRK09783 copper/silver efflux   68.5     4.7  0.0001   30.9   2.5   17   23-39    140-156 (409)
 91 cd06849 lipoyl_domain Lipoyl d  67.9     9.1  0.0002   20.1   3.0   22   20-41     19-40  (74)
 92 PF01551 Peptidase_M23:  Peptid  67.2     4.7  0.0001   24.2   1.9   18   23-40     57-74  (96)
 93 PRK06302 acetyl-CoA carboxylas  66.8      16 0.00034   24.9   4.6   18   21-38    137-154 (155)
 94 PRK00566 DNA-directed RNA poly  64.7      12 0.00025   33.5   4.4   35   15-62    964-998 (1156)
 95 cd06663 Biotinyl_lipoyl_domain  63.7      10 0.00022   21.6   2.8   22   21-42     19-40  (73)
 96 PRK05641 putative acetyl-CoA c  63.6     7.9 0.00017   26.6   2.6   17   22-38    136-152 (153)
 97 PRK14875 acetoin dehydrogenase  61.2      10 0.00022   26.8   3.0   17   22-38     23-39  (371)
 98 TIGR00999 8a0102 Membrane Fusi  59.9     6.1 0.00013   27.3   1.6   15   26-40      1-15  (265)
 99 PF13142 DUF3960:  Domain of un  59.2     5.1 0.00011   25.9   1.0   33   18-50     40-72  (87)
100 PLN02226 2-oxoglutarate dehydr  59.0      19 0.00042   29.0   4.4   18   22-39    149-166 (463)
101 COG0157 NadC Nicotinate-nucleo  57.2      11 0.00023   28.8   2.6   20   20-39     67-86  (280)
102 cd06255 M14_ASTE_ASPA_like_5 A  57.1      18 0.00038   26.6   3.7   27   13-39    234-262 (293)
103 PLN02983 biotin carboxyl carri  57.1      13 0.00028   28.4   3.0   27   17-43    214-240 (274)
104 TIGR00998 8a0101 efflux pump m  57.0      18 0.00039   26.0   3.6   18   22-39    219-236 (334)
105 PF13375 RnfC_N:  RnfC Barrel s  54.7      15 0.00033   23.5   2.7   21   18-38     41-61  (101)
106 cd06250 M14_PaAOTO_like An unc  53.7      21 0.00045   27.3   3.7   27   13-39    292-320 (359)
107 PF05896 NQRA:  Na(+)-transloca  53.1      13 0.00028   27.9   2.5   20   18-37     40-59  (257)
108 PRK09282 pyruvate carboxylase   52.4      22 0.00047   29.2   3.8   22   21-42    536-557 (592)
109 PRK10871 nlpD lipoprotein NlpD  52.2      19 0.00041   27.8   3.2   20   20-39    271-290 (319)
110 COG0508 AceF Pyruvate/2-oxoglu  52.2      14 0.00031   28.7   2.6   27   17-43     16-44  (404)
111 PRK10476 multidrug resistance   51.7      17 0.00036   26.7   2.8   18   22-39    223-240 (346)
112 MTH00025 ATP8 ATP synthase F0   51.6     6.4 0.00014   24.3   0.5   14   51-64     31-44  (70)
113 cd06253 M14_ASTE_ASPA_like_3 A  51.5      34 0.00074   25.3   4.4   29   12-40    231-261 (298)
114 TIGR02994 ectoine_eutE ectoine  51.0      25 0.00053   26.6   3.7   28   13-40    258-287 (325)
115 COG4942 Membrane-bound metallo  50.8      17 0.00036   29.3   2.8   34    8-41    352-393 (420)
116 cd04252 AAK_NAGK-fArgBP AAK_NA  50.4      35 0.00075   24.4   4.2   33   31-63    180-218 (248)
117 PF10011 DUF2254:  Predicted me  50.1      30 0.00065   26.4   4.1   36    4-39    200-245 (371)
118 PRK14875 acetoin dehydrogenase  49.6      45 0.00098   23.6   4.7   25   15-39     50-77  (371)
119 COG3608 Predicted deacylase [G  49.1      22 0.00049   27.6   3.2   28   13-40    259-288 (331)
120 PRK11637 AmiB activator; Provi  48.5      19 0.00042   27.6   2.8   21   20-40    380-400 (428)
121 cd06252 M14_ASTE_ASPA_like_2 A  48.4      30 0.00064   25.7   3.7   27   13-39    247-275 (316)
122 cd06251 M14_ASTE_ASPA_like_1 A  48.3      27 0.00059   25.5   3.5   27   13-39    222-250 (287)
123 TIGR00164 PS_decarb_rel phosph  46.9      29 0.00062   24.1   3.3   22   15-36    161-182 (189)
124 PRK05305 phosphatidylserine de  46.7      29 0.00064   24.4   3.3   22   14-35    180-201 (206)
125 PRK01202 glycine cleavage syst  46.5      35 0.00076   22.5   3.5   32   17-49     36-70  (127)
126 PTZ00144 dihydrolipoamide succ  45.9      23 0.00049   28.1   2.9   21   21-41     64-84  (418)
127 PLN02983 biotin carboxyl carri  45.0      52  0.0011   25.2   4.6   24   15-38    246-272 (274)
128 MTH00169 ATP8 ATP synthase F0   44.4      11 0.00024   22.8   0.8   16   51-66     31-46  (67)
129 TIGR03309 matur_yqeB selenium-  44.3      33 0.00072   25.8   3.5   29   13-41    167-197 (256)
130 PF12390 Se-cys_synth_N:  Selen  44.2      10 0.00023   20.3   0.6   12   51-62      3-14  (40)
131 cd06254 M14_ASTE_ASPA_like_4 A  42.8      41 0.00089   24.5   3.7   27   13-39    226-254 (288)
132 COG5471 Uncharacterized conser  40.9      16 0.00034   24.5   1.1   15   23-37     20-34  (107)
133 PRK12784 hypothetical protein;  40.8      42 0.00092   21.6   3.1   27   20-46     56-82  (84)
134 PRK15136 multidrug efflux syst  40.7      37  0.0008   25.8   3.3   18   22-39    230-247 (390)
135 PRK14042 pyruvate carboxylase   40.6      58  0.0013   27.0   4.6   22   21-42    539-560 (596)
136 PF15517 TBPIP_N:  TBP-interact  40.3      33 0.00072   22.7   2.6   15   15-29     68-82  (99)
137 PRK06978 nicotinate-nucleotide  39.5      31 0.00068   26.3   2.7   22   18-39     83-104 (294)
138 PRK05742 nicotinate-nucleotide  39.0      35 0.00076   25.5   2.9   21   19-39     68-88  (277)
139 PRK06096 molybdenum transport   38.9      31 0.00067   26.0   2.6   22   18-39     62-83  (284)
140 cd01572 QPRTase Quinolinate ph  38.5      37  0.0008   25.0   2.9   19   21-39     62-80  (268)
141 PRK09603 bifunctional DNA-dire  37.9      41 0.00089   33.1   3.6   22   15-36   2700-2721(2890)
142 cd04242 AAK_G5K_ProB AAK_G5K_P  37.8      31 0.00067   24.5   2.3   20   45-64    202-222 (251)
143 TIGR01334 modD putative molybd  37.1      38 0.00083   25.4   2.8   22   18-39     61-82  (277)
144 PRK14042 pyruvate carboxylase   36.9      42 0.00091   27.8   3.2   18   21-38    576-593 (596)
145 PRK07896 nicotinate-nucleotide  36.7      38 0.00082   25.6   2.7   20   20-39     79-98  (289)
146 TIGR00078 nadC nicotinate-nucl  35.1      45 0.00097   24.6   2.9   20   20-39     57-76  (265)
147 COG0739 NlpD Membrane proteins  34.9      29 0.00062   23.9   1.8   19   20-38    215-233 (277)
148 cd01568 QPRTase_NadC Quinolina  34.4      48   0.001   24.3   2.9   20   20-39     60-79  (269)
149 PRK09783 copper/silver efflux   34.4      53  0.0011   25.2   3.3   28   12-39    211-241 (409)
150 PRK08072 nicotinate-nucleotide  34.2      47   0.001   24.8   2.9   21   19-39     66-86  (277)
151 PRK14040 oxaloacetate decarbox  34.1      46 0.00099   27.4   3.0   24   20-43    537-560 (593)
152 PRK06543 nicotinate-nucleotide  33.9      47   0.001   25.1   2.9   22   18-39     66-87  (281)
153 PRK07428 nicotinate-nucleotide  33.9      44 0.00096   25.1   2.7   19   21-39     76-94  (288)
154 PRK11854 aceF pyruvate dehydro  33.8      50  0.0011   27.1   3.2   20   21-40     57-76  (633)
155 PF09891 DUF2118:  Uncharacteri  33.3      30 0.00064   24.1   1.6   22   21-42     94-115 (150)
156 TIGR01108 oadA oxaloacetate de  33.2      52  0.0011   27.0   3.2   24   20-43    530-553 (582)
157 PRK05848 nicotinate-nucleotide  33.2      46   0.001   24.8   2.7   21   19-39     60-80  (273)
158 PRK06106 nicotinate-nucleotide  33.1      49  0.0011   24.9   2.8   21   19-39     72-92  (281)
159 PRK05279 N-acetylglutamate syn  32.7      57  0.0012   25.0   3.2   47   15-61    200-256 (441)
160 PRK02899 adaptor protein; Prov  32.7      39 0.00084   24.0   2.2   34   27-60      4-42  (197)
161 PRK09016 quinolinate phosphori  32.4      48   0.001   25.3   2.7   21   19-39     87-107 (296)
162 PLN02716 nicotinate-nucleotide  32.4      51  0.0011   25.3   2.9   20   20-39     81-100 (308)
163 TIGR00761 argB acetylglutamate  31.9      29 0.00062   24.2   1.4   19   43-61    202-221 (231)
164 PF10199 Adaptin_binding:  Alph  31.8      26 0.00056   22.6   1.1   13   50-62      3-15  (137)
165 PRK05704 dihydrolipoamide succ  31.1      61  0.0013   25.3   3.2   18   22-39     60-77  (407)
166 KOG0559 Dihydrolipoamide succi  31.0      56  0.0012   26.6   3.0   20   21-40    129-148 (457)
167 PLN02226 2-oxoglutarate dehydr  30.9 1.2E+02  0.0025   24.6   4.8   38    5-42     86-132 (463)
168 cd01573 modD_like ModD; Quinol  30.9      53  0.0012   24.2   2.7   22   18-39     57-78  (272)
169 PRK08385 nicotinate-nucleotide  30.8      54  0.0012   24.6   2.7   22   18-39     59-80  (278)
170 PF01016 Ribosomal_L27:  Riboso  30.5      43 0.00094   21.3   1.9   17   22-38     23-39  (81)
171 cd04237 AAK_NAGS-ABP AAK_NAGS-  30.4      69  0.0015   23.4   3.2   55    7-61    174-247 (280)
172 PF00717 Peptidase_S24:  Peptid  29.8      69  0.0015   17.6   2.5   22   15-36     11-32  (70)
173 cd08607 GDPD_GDE5 Glycerophosp  29.8      82  0.0018   22.5   3.4   50   13-62     42-127 (290)
174 cd08583 PI-PLCc_GDPD_SF_unchar  29.2      46   0.001   23.1   2.0   49   13-61     36-94  (237)
175 TIGR01347 sucB 2-oxoglutarate   28.6      70  0.0015   25.0   3.1   19   21-39     57-75  (403)
176 cd08568 GDPD_TmGDE_like Glycer  28.0      96  0.0021   21.3   3.4   50   13-62     35-89  (226)
177 PF13667 ThiC-associated:  ThiC  27.9      28 0.00061   21.9   0.7   20   45-64     57-77  (80)
178 TIGR01235 pyruv_carbox pyruvat  27.4 1.3E+02  0.0028   26.9   4.8   24   20-43   1087-1110(1143)
179 PRK09454 ugpQ cytoplasmic glyc  27.4      59  0.0013   22.9   2.3   49   13-61     43-104 (249)
180 PRK14040 oxaloacetate decarbox  27.1 1.3E+02  0.0027   25.0   4.4   18   21-38    575-592 (593)
181 PTZ00144 dihydrolipoamide succ  27.0 1.5E+02  0.0033   23.5   4.8   20   21-40    101-120 (418)
182 PRK12999 pyruvate carboxylase;  27.0 1.2E+02  0.0025   27.1   4.4   23   20-42   1089-1111(1146)
183 TIGR00527 gcvH glycine cleavag  26.7      86  0.0019   20.6   2.9   32   17-49     35-69  (127)
184 cd04236 AAK_NAGS-Urea AAK_NAGS  26.6 1.2E+02  0.0026   22.6   3.9   58    6-63    165-244 (271)
185 TIGR01348 PDHac_trf_long pyruv  26.5      59  0.0013   26.3   2.5   24   20-43    134-157 (546)
186 PLN02528 2-oxoisovalerate dehy  26.4      82  0.0018   24.7   3.1   19   21-39     55-73  (416)
187 PRK13380 glycine cleavage syst  26.1 1.3E+02  0.0028   20.4   3.8   26   18-43     44-72  (144)
188 KOG0369 Pyruvate carboxylase [  26.1      96  0.0021   27.7   3.7   26   17-42   1114-1141(1176)
189 PRK05704 dihydrolipoamide succ  26.1 1.6E+02  0.0036   23.0   4.7   20   22-41     23-42  (407)
190 PRK14906 DNA-directed RNA poly  25.8      38 0.00081   31.3   1.3   36   15-63   1061-1098(1460)
191 PF10262 Rdx:  Rdx family;  Int  25.7 1.1E+02  0.0023   18.0   3.0   20   38-61     53-72  (76)
192 cd06462 Peptidase_S24_S26 The   25.2      71  0.0015   17.8   2.0   21   15-35     14-35  (84)
193 PRK11854 aceF pyruvate dehydro  25.1      73  0.0016   26.2   2.8   17   22-38    225-241 (633)
194 PRK12999 pyruvate carboxylase;  24.9      71  0.0015   28.4   2.8   17   22-38   1128-1144(1146)
195 PRK11855 dihydrolipoamide acet  24.8      85  0.0018   25.2   3.0   17   22-38     22-38  (547)
196 PF01538 HCV_NS2:  Hepatitis C   24.8      23 0.00049   26.0  -0.2   15   41-55    179-193 (195)
197 PF01987 AIM24:  Mitochondrial   24.4 1.6E+02  0.0035   20.1   4.0   30    5-34      6-35  (215)
198 cd08601 GDPD_SaGlpQ_like Glyce  24.2 1.2E+02  0.0025   21.3   3.3   49   13-61     36-107 (256)
199 COG4770 Acetyl/propionyl-CoA c  24.1      72  0.0016   27.2   2.6   19   22-40    590-608 (645)
200 cd06848 GCS_H Glycine cleavage  24.0 1.2E+02  0.0026   18.5   3.1   25   23-48     37-61  (96)
201 PRK11856 branched-chain alpha-  23.8      98  0.0021   23.7   3.1   16   23-38     61-76  (411)
202 PF01597 GCV_H:  Glycine cleava  23.7 1.5E+02  0.0033   19.2   3.6   19   24-42     40-58  (122)
203 PLN00208 translation initiatio  23.6 2.2E+02  0.0048   19.8   4.6   48    3-50     27-93  (145)
204 TIGR01235 pyruv_carbox pyruvat  23.4      85  0.0018   28.0   3.0   14    4-17   1079-1092(1143)
205 TIGR02712 urea_carbox urea car  23.0      84  0.0018   28.0   2.9   20   21-40   1146-1165(1201)
206 TIGR03806 chp_HNE_0200 conserv  22.9      79  0.0017   24.2   2.4   45   13-62     44-90  (317)
207 PRK06559 nicotinate-nucleotide  22.9      82  0.0018   23.9   2.5   17   23-39     79-95  (290)
208 TIGR01348 PDHac_trf_long pyruv  22.8   1E+02  0.0022   24.9   3.2   19   21-39     56-74  (546)
209 TIGR02927 SucB_Actino 2-oxoglu  22.1   1E+02  0.0022   25.3   3.0   18   22-39    156-173 (590)
210 cd08565 GDPD_pAtGDE_like Glyce  21.3 1.1E+02  0.0024   21.5   2.7   51   14-64     35-93  (235)
211 TIGR01936 nqrA NADH:ubiquinone  21.3      82  0.0018   25.2   2.3   20   19-38     41-60  (447)
212 PF02785 Biotin_carb_C:  Biotin  21.3      76  0.0016   20.5   1.8   30    3-34     13-42  (107)
213 PF09160 FimH_man-bind:  FimH,   21.1      71  0.0015   22.2   1.7   21   25-45    114-134 (147)
214 PRK11892 pyruvate dehydrogenas  21.1 1.2E+02  0.0025   24.3   3.1   17   22-38     23-39  (464)
215 PRK08662 nicotinate phosphorib  20.9 1.1E+02  0.0024   23.4   2.9   21   19-39     71-91  (343)
216 PF03120 DNA_ligase_OB:  NAD-de  20.0      23 0.00051   22.2  -0.8   29   29-65     50-78  (82)

No 1  
>CHL00117 rpoC2 RNA polymerase beta'' subunit; Reviewed
Probab=99.93  E-value=6e-27  Score=199.25  Aligned_cols=69  Identities=58%  Similarity=0.795  Sum_probs=66.2

Q ss_pred             CCCCCCCcEEEEE-------------eCCCcEEEEecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhcCCcccc
Q 042693            2 HTHLKSDQILIVQ-------------ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLIL   68 (71)
Q Consensus         2 ~~~~~sGqii~i~-------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~~~i~   68 (71)
                      .++ +||||+.++             +++||++|+++||+|++||+|+||.||++|||||||||||||||||||+.++++
T Consensus      1073 ~~~-~SGQIi~I~~~~lvIR~akPYLat~GAtvh~~~GeiI~~GDtLvtLiyER~kSGDI~QGLPKVEqLLEARsi~sis 1151 (1364)
T CHL00117       1073 GPH-KSGQIIIVQVDSLVIRSAKPYLATPGATVHGHYGEILYEGDTLVTLIYEKSRSGDITQGLPKVEQLLEARSIDSIS 1151 (1364)
T ss_pred             Ccc-ccceEEEEecCeEEEEecCceecCCCcEEEccCCCEecCCCeEEEEEeeccccCCcccCchhHHhhhhhccCceee
Confidence            455 999999998             899999999999999999999999999999999999999999999999999999


Q ss_pred             ccC
Q 042693           69 ACL   71 (71)
Q Consensus        69 ~~l   71 (71)
                      +||
T Consensus      1152 ~nl 1154 (1364)
T CHL00117       1152 MNL 1154 (1364)
T ss_pred             cch
Confidence            986


No 2  
>TIGR02388 rpoC2_cyan DNA-directed RNA polymerase, beta'' subunit. The family consists of the product of the rpoC2 gene, a subunit of DNA-directed RNA polymerase of cyanobacteria and chloroplasts. RpoC2 corresponds largely to the C-terminal region of the RpoC (the beta' subunit) of other bacteria. Members of this family are designated beta'' in chloroplasts/plastids, and beta' (confusingly) in Cyanobacteria, where RpoC1 is called beta' in chloroplasts/plastids and gamma in Cyanobacteria. We prefer to name this family beta'', after its organellar members, to emphasize that this RpoC1 and RpoC2 together replace RpoC in other bacteria.
Probab=99.91  E-value=3.9e-25  Score=186.88  Aligned_cols=65  Identities=23%  Similarity=0.475  Sum_probs=62.2

Q ss_pred             CCCCCCCCcEEEEE-------------eCCCcEEEEecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhcCCc
Q 042693            1 DHTHLKSDQILIVQ-------------ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFD   65 (71)
Q Consensus         1 ~~~~~~sGqii~i~-------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~~   65 (71)
                      +.++++||||+.++             +++||++|+++|++|++||+|++|+||++|||||||||||||||||||+++
T Consensus       917 ~~~~~~SGqvi~i~~~~v~iR~akPYl~s~ga~~~~~~g~~v~~Gd~L~~l~~er~ktgDI~qGLPrveellEaR~~k  994 (1227)
T TIGR02388       917 GVKAEESGEIEEVASDYVILRIGRPYRVSPGAVLHIEDGDLVQRGDNLALLVFERAKTGDIVQGLPRIEELLEARKPK  994 (1227)
T ss_pred             CCccCCCceEEEEeCCeEEEEecceeEcCCCCEEEecCCCEecCCCEEEEEEeeecccCccccCchhHHHHHhccCCc
Confidence            35789999999988             899999999999999999999999999999999999999999999999993


No 3  
>PRK02597 rpoC2 DNA-directed RNA polymerase subunit beta'; Provisional
Probab=99.90  E-value=2.6e-24  Score=182.92  Aligned_cols=65  Identities=22%  Similarity=0.484  Sum_probs=62.3

Q ss_pred             CCCCCCCCcEEEEE-------------eCCCcEEEEecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhcCCc
Q 042693            1 DHTHLKSDQILIVQ-------------ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFD   65 (71)
Q Consensus         1 ~~~~~~sGqii~i~-------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~~   65 (71)
                      +.++++||||++++             +++||++|+++|++|++||+|++|+||++|||||||||||||||||||+++
T Consensus       919 ~~~~~~SGqvi~i~~~~v~iR~a~Pyl~s~ga~~~~~~g~~v~~Gd~L~~l~~er~ktgDI~qGLPrveellEaR~pk  996 (1331)
T PRK02597        919 GVPAPESGEVEAVSGGSVTLRLGRPYRVSPGAVLHVRDGDLVQRGDNLALLVFERAKTGDIIQGLPRIEELLEARKPK  996 (1331)
T ss_pred             CCccCCCccEEEEeCCeEEEEeccceEcCCCCEEEecCCCEecCCCeEEEEEeeecccCCccCCCceeeEeEEEecCC
Confidence            35789999999998             899999999999999999999999999999999999999999999999995


No 4  
>PRK14844 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional
Probab=99.59  E-value=3.4e-16  Score=139.66  Aligned_cols=52  Identities=23%  Similarity=0.294  Sum_probs=50.7

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhcCCcc
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDL   66 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~~~   66 (71)
                      +|.||+|.|++|+.|++||+||++|++..+|.|||||||||+||||||+++.
T Consensus      2520 lp~ga~l~v~~g~~v~~Gdilakipr~~~~t~DIT~GLpRv~eLFEar~pk~ 2571 (2836)
T PRK14844       2520 IPIGAVLNVQDGQKVHAGDVITRTPRESVKTRDITGGLPRVIELFEARRPKE 2571 (2836)
T ss_pred             cCCCceEeeccCceecccceeecccccccccCccCCCCccchheeeeecCCC
Confidence            9999999999999999999999999999999999999999999999999964


No 5  
>PRK09603 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Reviewed
Probab=99.58  E-value=1.4e-15  Score=136.03  Aligned_cols=59  Identities=17%  Similarity=0.197  Sum_probs=53.3

Q ss_pred             CCcEEEEEeCCCcEEEEecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhc--CCc
Q 042693            7 SDQILIVQATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIR--SFD   65 (71)
Q Consensus         7 sGqii~i~~~~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR--~~~   65 (71)
                      +|.+....+|+||+|+|++|+.|++||+||++|++..||.|||||||||+||||||  +++
T Consensus      2602 ~~~~~~y~lp~~~~l~v~~g~~v~~gdilak~p~~~~~t~DITgGLprv~eLfear~~~pk 2662 (2890)
T PRK09603       2602 NGEEIRYFLEPKTSIAISDGSSVEQAEVLAKIPKATVKSRDITGGLPRVSELFEARKPKPK 2662 (2890)
T ss_pred             CCcEEEEecCCCcEEEecCCCEecccceEeeccccccccccccCCcccchhheEeecCCCC
Confidence            45555444999999999999999999999999999999999999999999999999  554


No 6  
>TIGR02386 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit, predominant form. Bacteria have a single DNA-directed RNA polymerase, with required subunits that include alpha, beta, and beta-prime. This model describes the predominant architecture of the beta-prime subunit in most bacteria. This model excludes from among the bacterial mostly sequences from the cyanobacteria, where RpoC is replaced by two tandem genes homologous to it but also encoding an additional domain.
Probab=98.35  E-value=1.5e-07  Score=80.79  Aligned_cols=21  Identities=33%  Similarity=0.491  Sum_probs=19.3

Q ss_pred             CCccCchhhHhhhhhhcCCcc
Q 042693           46 CDLTRALSKVKQVLEIRSFDL   66 (71)
Q Consensus        46 ~DItqGLPkVeeLfEAR~~~~   66 (71)
                      +|||||||||+||||||+++.
T Consensus       904 ~DIT~GlpRv~elfear~p~~  924 (1140)
T TIGR02386       904 GDITQGLPRVKELFEARTPKD  924 (1140)
T ss_pred             cccccCchhhhhhhhcccCCC
Confidence            399999999999999999964


No 7  
>cd00630 RNAP_largest_subunit_C Largest subunit of RNA polymerase (RNAP), C-terminal domain. RNA polymerase (RNAP) is a large multi-subunit complex responsible for the synthesis of RNA. It is the principal enzyme of the transcription process, and is the final target in many regulatory pathways that control gene expression in all living cells. At least three distinct RNAP complexes are found in eukaryotic nuclei, RNAP I, RNAP II, and RNAP III, for the synthesis of ribosomal RNA precursor, mRNA precursor, and 5S and tRNA, respectively. A single distinct RNAP complex is found in prokaryotes and archaea, which may be responsible for the synthesis of all RNAs. Structure studies revealed that prokaryotic and eukaryotic RNAPs share a conserved crab-claw-shape structure. The largest and the second largest subunits each make up one clamp, one jaw, and part of the cleft. The largest RNAP subunit (Rpb1) interacts with the second-largest RNAP subunit (Rpb2) to form the DNA entry and RNA exit channe
Probab=98.28  E-value=6.3e-08  Score=67.17  Aligned_cols=35  Identities=29%  Similarity=0.462  Sum_probs=30.0

Q ss_pred             eEEEEEeehhccCCccCchhhHhhhhhhcCCcccc
Q 042693           34 KLVTFIYEKLRSCDLTRALSKVKQVLEIRSFDLIL   68 (71)
Q Consensus        34 ~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~~~i~   68 (71)
                      +|.++.+++.++.|||||+||+||+||||....+.
T Consensus        20 tl~t~~~~~~~~~~~t~~~pk~~~~~~~~dI~~i~   54 (158)
T cd00630          20 TLRTFHFAGVASMNVTLGLPRLKEILNAASIHEML   54 (158)
T ss_pred             hhhhhhhccccccccccCCccchhhcccccHHHHH
Confidence            35688899999999999999999999999665443


No 8  
>PRK14906 DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional
Probab=98.28  E-value=2.8e-07  Score=80.56  Aligned_cols=25  Identities=24%  Similarity=0.332  Sum_probs=21.3

Q ss_pred             hhccCCccCchhhHhhhhhhcCCcc
Q 042693           42 KLRSCDLTRALSKVKQVLEIRSFDL   66 (71)
Q Consensus        42 ~~kt~DItqGLPkVeeLfEAR~~~~   66 (71)
                      ..-++|||||||||+||||||+++.
T Consensus      1001 Gv~~~dit~GLpRv~eLfEar~pk~ 1025 (1460)
T PRK14906       1001 GVAGDDITQGLPRVAELFEARKPKG 1025 (1460)
T ss_pred             cccccccccCcchhhhheeeccCCC
Confidence            3334799999999999999999864


No 9  
>PRK00566 DNA-directed RNA polymerase subunit beta'; Provisional
Probab=98.13  E-value=8.2e-07  Score=76.40  Aligned_cols=41  Identities=20%  Similarity=0.340  Sum_probs=29.1

Q ss_pred             CcEEecCCeEEEEEeeh------------hccC--CccCchhhHhhhhhhcCCcc
Q 042693           26 GAFLHKGNKLVTFIYEK------------LRSC--DLTRALSKVKQVLEIRSFDL   66 (71)
Q Consensus        26 G~~V~~G~~L~~l~~e~------------~kt~--DItqGLPkVeeLfEAR~~~~   66 (71)
                      |..|.-|+.+..+.-++            +-||  |||||||||+||||||+++.
T Consensus       873 ~~~v~iGeaVGiIAAQSIGEPGTQLTmRTFHtGGvdIT~Glprv~elfear~pk~  927 (1156)
T PRK00566        873 GKLVNIGEAVGVIAAQSIGEPGTQLTMRTFHTGGVDITGGLPRVAELFEARKPKG  927 (1156)
T ss_pred             CCCcccCcceeEEeeeecCCCccceeeeeeeecceeccCCccchhhheeeccCCC
Confidence            55666666665443332            2233  99999999999999999964


No 10 
>cd02655 RNAP_beta'_C Largest subunit (beta') of Bacterial DNA-dependent RNA polymerase (RNAP), C-terminal domain. Bacterial RNA polymerase (RNAP) is a large multi-subunit complex responsible for the synthesis of all RNAs in the cell. This family also includes the eukaryotic plastid-encoded RNAP beta" subunit. Structure studies suggest that RNAP complexes from different organisms share a crab-claw-shape structure with two pincers defining a central cleft. Beta' and beta, the largest and the second largest subunits of bacterial RNAP, each makes up one pincer and part of the base of the cleft. The C-terminal domain includes a G loop that forms part of the floor of the downstream DNA-binding cavity. The position of the G loop may determine the switch of the bridge helix between flipped-out and normal alpha-helical conformations.
Probab=97.52  E-value=3.6e-05  Score=55.49  Aligned_cols=19  Identities=32%  Similarity=0.655  Sum_probs=17.5

Q ss_pred             CCccCchhhHhhhhhhcCC
Q 042693           46 CDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        46 ~DItqGLPkVeeLfEAR~~   64 (71)
                      .||||||||++||||+|+.
T Consensus        36 ~dIt~Glprv~el~e~r~~   54 (204)
T cd02655          36 TDITQGLPRVEELFEARKI   54 (204)
T ss_pred             cccccccHHHHHHHHhhcC
Confidence            3999999999999999983


No 11 
>PF13533 Biotin_lipoyl_2:  Biotin-lipoyl like
Probab=96.26  E-value=0.0048  Score=34.84  Aligned_cols=25  Identities=20%  Similarity=0.299  Sum_probs=20.7

Q ss_pred             EEEEecCcEEecCCeEEEEEeehhc
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYEKLR   44 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e~~k   44 (71)
                      .++|++|+.|++||+|++|-...+.
T Consensus        15 ~v~V~~G~~VkkGd~L~~ld~~~~~   39 (50)
T PF13533_consen   15 SVYVKEGQQVKKGDVLLVLDSPDLQ   39 (50)
T ss_pred             EEEecCCCEEcCCCEEEEECcHHHH
Confidence            3479999999999999999766543


No 12 
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. DevB from Anabaena sp. strain PCC 7120 is partially characterized as a membrane fusion protein of the DevBCA ABC exporter, probably a glycolipid exporter, required for heterocyst formation. Most Cyanobacteria have one member only, but Nostoc sp. PCC 7120 has seven members.
Probab=94.86  E-value=0.044  Score=39.67  Aligned_cols=35  Identities=14%  Similarity=0.159  Sum_probs=27.2

Q ss_pred             CCcEEEEEeCCC------cEEEEecCcEEecCCeEEEEEee
Q 042693            7 SDQILIVQATPG------AISFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus         7 sGqii~i~~~~g------a~l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      ++.++.+..+.+      ..++|++||.|++||+|++|--.
T Consensus        10 ~~~~~~v~~~~~~~~G~V~~i~V~eG~~V~~G~~L~~ld~~   50 (327)
T TIGR02971        10 EGEVVAVAAPSSGGTDRIKKLLVAEGDRVQAGQVLAELDSR   50 (327)
T ss_pred             cCceEEecCCCCCCCcEEEEEEccCCCEecCCcEEEEecCc
Confidence            345556666666      45689999999999999999864


No 13 
>PF00529 HlyD:  HlyD family secretion protein the corresponding Prosite entry.;  InterPro: IPR006143 This entry represents a large family of polypeptides, the MFP (for membrane fusion protein) family. MFPs are a component of the of the RND family of transporters (RND refers to resistance, nodulation, and cell division). MFPs are proposed to span the periplasm in some way linking the inner and outer membranes []. However, some members of this family are found in Gram-positive bacteria, where there is no outer membrane. MFPs are involved in the export of a variety of compounds, from drug molecules to large polypeptides, and are united by their similar overall structural organisation, combined with some conserved regions [].  This family includes:   Haemolysin secretion protein D (HlyD) from Escherichia coli.  Lactococcin A secretion protein LcnD from Lactococcus lactis []. RTX-I toxin determinant D from Actinobacillus pleuropneumoniae.  Calmodulin-sensitive adenylate cyclase-haemolysin (cyclolysin) CyaD from Bordetella pertussis.  Colicin V secretion protein CvaA from E. coli []. Proteases secretion protein PrtE from Erwinia chrysanthemi [].  Alkaline protease secretion protein AprE from Pseudomonas aeruginosa []. Several multidrug resistance proteins [].  ; GO: 0055085 transmembrane transport, 0016020 membrane; PDB: 1T5E_E 1VF7_K 2V4D_I 4DK1_C 2F1M_B.
Probab=94.62  E-value=0.036  Score=38.78  Aligned_cols=22  Identities=18%  Similarity=0.152  Sum_probs=15.0

Q ss_pred             EEEecCcEEecCCeEEEEEeeh
Q 042693           21 SFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      |+|++|+.|++||+|++|--..
T Consensus        15 i~V~eG~~VkkGq~L~~LD~~~   36 (305)
T PF00529_consen   15 ILVKEGQRVKKGQVLARLDPTD   36 (305)
T ss_dssp             E-S-TTEEE-TTSECEEE--HH
T ss_pred             EEccCcCEEeCCCEEEEEEeec
Confidence            4799999999999999997443


No 14 
>cd02736 RNAP_III_Rpc1_C Largest subunit (Rpc1) of Eukaryotic RNA polymerase III (RNAP III), C-terminal domain. Eukaryotic RNA polymerase III (RNAP III) is a large multi-subunit complex responsible for the synthesis of tRNAs, 5SrRNA, Alu-RNA, U6 snRNA, among others. Rpc1 is also known as C160 in yeast. Structure studies suggest that different RNA polymerase complexes share a similar crab-claw-shape structure. The C-terminal domain of Rpb1, the largest subunit of RNAP II, makes up part of the foot and jaw structures of RNAP II. The similarity between this domain and the C-terminal domain of Rpb1, its counterpart in RNAP II, suggests a similar functional and structural role.
Probab=94.37  E-value=0.023  Score=42.90  Aligned_cols=32  Identities=19%  Similarity=0.371  Sum_probs=28.6

Q ss_pred             CeEEEEEeehhccCCccCchhhHhhhhhhcCC
Q 042693           33 NKLVTFIYEKLRSCDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        33 ~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~   64 (71)
                      -+|-||.+....+-++|+|+||+.|++.|++.
T Consensus        28 mTL~TFH~aGv~~~nvtlGvPRlkEIinasK~   59 (300)
T cd02736          28 MTLKTFHFAGVASMNITLGVPRIKEIINASKN   59 (300)
T ss_pred             ccccccccccccccccccCchHHHHHHhcccC
Confidence            35778889888888999999999999999986


No 15 
>cd06528 RNAP_A'' A'' subunit of Archaeal RNA Polymerase (RNAP). Archaeal RNA polymerase (RNAP), like bacterial RNAP, is a large multi-subunit complex responsible for the synthesis of all RNAs in the cell. The relative positioning of the RNAP core is highly conserved between archaeal RNAP and the three classes of eukaryotic RNAPs. In archaea, the largest subunit is split into two polypeptides, A' and A'', which are encoded by separate genes in an operon. Sequence alignments reveal that the archaeal A'' subunit corresponds to the C-terminal one-third of the RNAPII largest subunit (Rpb1). In subunit A'', several loops in the jaw domain are shorter. The RNAPII Rpb1 interacts with the second-largest subunit (Rpb2) to form the DNA entry and RNA exit channels in addition to the catalytic center of RNA synthesis.
Probab=94.35  E-value=0.019  Score=44.41  Aligned_cols=32  Identities=22%  Similarity=0.368  Sum_probs=28.5

Q ss_pred             CeEEEEEeehhccCCccCchhhHhhhhhhcCC
Q 042693           33 NKLVTFIYEKLRSCDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        33 ~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~   64 (71)
                      -+|=||.|....+.++|+|+||+.|++.|++.
T Consensus        58 MTLnTFH~AGVas~nVTlGVPRlkEIIna~K~   89 (363)
T cd06528          58 MTLRTFHYAGVAEINVTLGLPRLIEIVDARKE   89 (363)
T ss_pred             cccccccccccccccCccccccHHHHhhcccC
Confidence            35678889989899999999999999999986


No 16 
>PF04998 RNA_pol_Rpb1_5:  RNA polymerase Rpb1, domain 5;  InterPro: IPR007081 RNA polymerases catalyse the DNA dependent polymerisation of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial and chloroplast polymerases). This domain, domain 5, represents the discontinuous cleft domain that is required to form the central cleft or channel where the DNA is bound [, ].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 1ZYR_D 1SMY_D 2A68_N 2O5J_D 3AOH_N 2O5I_D 2CW0_N 2A6H_N 2A69_D 3EQL_D ....
Probab=94.26  E-value=0.011  Score=41.09  Aligned_cols=30  Identities=17%  Similarity=0.254  Sum_probs=24.6

Q ss_pred             EEEeehhccCCccCchhhHhhhhhhcCCcc
Q 042693           37 TFIYEKLRSCDLTRALSKVKQVLEIRSFDL   66 (71)
Q Consensus        37 ~l~~e~~kt~DItqGLPkVeeLfEAR~~~~   66 (71)
                      ||...-..+.|+++|+||++|+|++++...
T Consensus        93 TFH~aG~~~~~vt~giprl~eii~~~~~~~  122 (277)
T PF04998_consen   93 TFHTAGVASKNVTQGIPRLKEIINASKKIK  122 (277)
T ss_dssp             CTSSSCSSTSSCSSSHHHHHHHHTTCSSSS
T ss_pred             ccccCceeeecccccceeeccccccccccc
Confidence            555555667899999999999999998853


No 17 
>TIGR02389 RNA_pol_rpoA2 DNA-directed RNA polymerase, subunit A''. This family consists of the archaeal A'' subunit of the DNA-directed RNA polymerase. The example from Methanocaldococcus jannaschii contains an intein.
Probab=94.25  E-value=0.024  Score=43.99  Aligned_cols=32  Identities=19%  Similarity=0.369  Sum_probs=28.6

Q ss_pred             CeEEEEEeehhccCCccCchhhHhhhhhhcCC
Q 042693           33 NKLVTFIYEKLRSCDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        33 ~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~   64 (71)
                      -+|=||.|....+.++|+|+||+.|++-|++.
T Consensus        62 MTLnTFH~AGVas~nVTlGVPRlkEIINa~k~   93 (367)
T TIGR02389        62 MTMRTFHYAGVAELNVTLGLPRLIEIVDARKT   93 (367)
T ss_pred             ccccccccccccccCccccchhHHHHhhcccC
Confidence            35778889999899999999999999999886


No 18 
>PRK04309 DNA-directed RNA polymerase subunit A''; Validated
Probab=94.17  E-value=0.026  Score=43.92  Aligned_cols=32  Identities=19%  Similarity=0.356  Sum_probs=28.3

Q ss_pred             CeEEEEEeehhccCCccCchhhHhhhhhhcCC
Q 042693           33 NKLVTFIYEKLRSCDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        33 ~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~   64 (71)
                      -+|=||.+....+.++|+|+||+.|++-||+.
T Consensus        77 MTL~TFH~AGva~~nVTlGvPRlkEIina~K~  108 (383)
T PRK04309         77 MTMRTFHYAGVAEINVTLGLPRLIEIVDARKE  108 (383)
T ss_pred             cccccccccCccccCcccCchhHHHHHhcccC
Confidence            35778889888888999999999999999985


No 19 
>PRK14897 unknown domain/DNA-directed RNA polymerase subunit A'' fusion protein; Provisional
Probab=93.41  E-value=0.039  Score=44.79  Aligned_cols=32  Identities=19%  Similarity=0.364  Sum_probs=29.1

Q ss_pred             CeEEEEEeehhccCCccCchhhHhhhhhhcCC
Q 042693           33 NKLVTFIYEKLRSCDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        33 ~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~   64 (71)
                      -+|=||.|....+.++|+|+||+.|++-||+.
T Consensus       200 MTLnTFH~AGVas~NVTlGVPRLkEIINa~K~  231 (509)
T PRK14897        200 MTMRTFHYAGVAEMNVTLGLPRLIEIVDARKK  231 (509)
T ss_pred             ccccccccccccccccccCcchhHHHhhcccC
Confidence            36789999999899999999999999999887


No 20 
>cd02584 RNAP_II_Rpb1_C Largest subunit (Rpb1) of Eukaryotic RNA polymerase II (RNAP II), C-terminal domain. RNA polymerase II (RNAP II) is a large multi-subunit complex responsible for the synthesis of mRNA. RNAP II consists of a 10-subunit core enzyme and a peripheral heterodimer of two subunits. The largest core subunit (Rpb1) of yeast RNAP II is the best characterized member of this family. Structure studies suggest that RNAP complexes from different organisms share a crab-claw-shape structure. In yeast, Rpb1 and Rpb2, the largest and the second largest subunits, each makes up one clamp, one jaw, and part of the cleft. Rpb1 interacts with Rpb2 to form the DNA entry and RNA exit channels in addition to the catalytic center of RNA synthesis. The C-terminal domain of Rpb1 makes up part of the foot and jaw structures.
Probab=93.13  E-value=0.041  Score=43.21  Aligned_cols=31  Identities=16%  Similarity=0.386  Sum_probs=27.7

Q ss_pred             eEEEEEeehhccCCccCchhhHhhhhhhcCC
Q 042693           34 KLVTFIYEKLRSCDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        34 ~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~   64 (71)
                      +|=||.+....+.++|+|+||+.|++-|++.
T Consensus        46 TLnTFH~AGVas~NVTlGVPRLkEIInasK~   76 (410)
T cd02584          46 TLNTFHFAGVSAKNVTLGVPRLKEIINVAKN   76 (410)
T ss_pred             cccccccccccccccccCccchHHHhhcccC
Confidence            4778889888899999999999999999875


No 21 
>PF07831 PYNP_C:  Pyrimidine nucleoside phosphorylase C-terminal domain;  InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ]. It has slightly different conformations in different members of this family. For example, in pyrimidine nucleoside phosphorylase (PYNP, P77826 from SWISSPROT) there is an added three-stranded anti-parallel beta sheet as compared to other members of the family, such as Escherichia coli thymidine phosphorylase (TP, P07650 from SWISSPROT) []. The domain contains an alpha/ beta hammerhead fold and residues in this domain seem to be important in formation of the homodimer []. ; GO: 0016763 transferase activity, transferring pentosyl groups, 0006213 pyrimidine nucleoside metabolic process; PDB: 1AZY_A 1OTP_A 2TPT_A 3H5Q_A 1BRW_A 2WK5_C 2J0F_C 2WK6_B 1UOU_A 2DSJ_B ....
Probab=93.09  E-value=0.075  Score=32.60  Aligned_cols=29  Identities=21%  Similarity=0.257  Sum_probs=23.6

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEEeehh
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      ...|-.++++-||.|++||+|+++.++..
T Consensus        30 ~~vGi~l~~k~Gd~V~~Gd~l~~i~~~~~   58 (75)
T PF07831_consen   30 PAVGIELHKKVGDRVEKGDPLATIYANDE   58 (75)
T ss_dssp             TT-EEEESS-TTSEEBTTSEEEEEEESSS
T ss_pred             cCcCeEecCcCcCEECCCCeEEEEEcCCh
Confidence            45677899999999999999999998754


No 22 
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein. This family represents an accessory protein that works with the bacteriocin maturation and ABC transport secretion protein described by TIGR01193.
Probab=92.99  E-value=0.18  Score=38.88  Aligned_cols=33  Identities=21%  Similarity=0.338  Sum_probs=24.9

Q ss_pred             EEEEEeCCCcEE---EEecCcEEecCCeEEEEEeeh
Q 042693           10 ILIVQATPGAIS---FRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        10 ii~i~~~~ga~l---~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      +..|+.+.|++|   +|++||.|++||+|++|--..
T Consensus        59 ~~~vq~~~~G~v~~i~V~eG~~V~~G~~L~~ld~~~   94 (457)
T TIGR01000        59 LSKIQSTSNNAIKENYLKENKFVKKGDLLVVYDNGN   94 (457)
T ss_pred             eEEEEcCCCcEEEEEEcCCCCEecCCCEEEEECchH
Confidence            334446666665   699999999999999996443


No 23 
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A).
Probab=92.39  E-value=0.22  Score=35.85  Aligned_cols=32  Identities=13%  Similarity=0.087  Sum_probs=24.1

Q ss_pred             EEEeCCCcE---EEEecCcEEecCCeEEEEEeehh
Q 042693           12 IVQATPGAI---SFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        12 ~i~~~~ga~---l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      .++.+.++.   ++++.||.|++||+|++|-....
T Consensus        44 ~v~a~~~G~V~~i~v~~G~~V~kGq~L~~ld~~~~   78 (334)
T TIGR00998        44 QVSSQVSGSVIEVNVDDTDYVKQGDVLVRLDPTNA   78 (334)
T ss_pred             EEcccCceEEEEEEeCCCCEEcCCCEEEEECchHH
Confidence            444555555   47999999999999999975543


No 24 
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein. Members of this protein family are homologs of the HlyD membrane fusion protein of type I secretion systems. Their occurrence in prokaryotic genomes is associated with the occurrence of a novel class of microcin (small bacteriocins) with a propeptide region related to nitrile hydratase. We designate the class of bacteriocin as Nitrile Hydratase Propeptide Microcin, or NHPM. This family, therefore, is designated as NHPM bacteriocin system secretion protein. Some but not all NHPM-class putative microcins belong to the TOMM (thiazole/oxazole modified microcin) class as assessed by the presence of the scaffolding protein and/or cyclodehydratase in the same gene clusters.
Probab=92.02  E-value=0.26  Score=37.32  Aligned_cols=38  Identities=18%  Similarity=0.253  Sum_probs=29.2

Q ss_pred             CCcEEEEEeCCCcEE---EEecCcEEecCCeEEEEEeehhc
Q 042693            7 SDQILIVQATPGAIS---FRHYGAFLHKGNKLVTFIYEKLR   44 (71)
Q Consensus         7 sGqii~i~~~~ga~l---~v~~G~~V~~G~~L~~l~~e~~k   44 (71)
                      +|.+..++.+.++.|   +|++|+.|++|++|+++--....
T Consensus        55 ~~~~~~v~a~~~G~V~~i~V~eG~~V~kGq~L~~l~~~~~~   95 (421)
T TIGR03794        55 SSGVDTIQSPGSGVVIDLDVEVGDQVKKGQVVARLFQPELR   95 (421)
T ss_pred             CCceeEEECCCCeEEEEEECCCcCEECCCCEEEEECcHHHH
Confidence            445556666666665   69999999999999999876553


No 25 
>TIGR00830 PTBA PTS system, glucose subfamily, IIA component. These are part of the The PTS Glucose-Glucoside (Glc) SuperFamily. The Glc family includes permeases specific for glucose, N-acetylglucosamine and a large variety of a- and b-glucosides. However, not all b-glucoside PTS permeases are in this class, as the cellobiose (Cel) b-glucoside PTS permease is in the Lac family (TC #4.A.3). The IIA, IIB and IIC domains of all of the permeases listed below are demonstrably homologous. These permeases show limited sequence similarity with members of the Fru family (TC #4.A.2). Several of the PTS permeases in the Glc family lack their own IIA domains and instead use the glucose IIA protein (IIAglc or Crr). Most of these permeases have the B and C domains linked together in a single polypeptide chain, and a cysteyl residue in the IIB domain is phosphorylated by direct phosphoryl transfer from IIAglc(his~P). Those permeases which lack a IIA domain include the maltose (Mal), arbutin-salicin-c
Probab=91.98  E-value=0.31  Score=32.55  Aligned_cols=30  Identities=23%  Similarity=0.340  Sum_probs=25.7

Q ss_pred             CCcEEEEecCcEEecCCeEEEEEeehhccC
Q 042693           17 PGAISFRHYGAFLHKGNKLVTFIYEKLRSC   46 (71)
Q Consensus        17 ~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~   46 (71)
                      .|=..+++.||.|++||.|+++-.+.++..
T Consensus        80 ~gF~~~v~~Gd~V~~G~~l~~~D~~~i~~~  109 (121)
T TIGR00830        80 EGFTSHVEEGQRVKKGDPLLEFDLKAIKKK  109 (121)
T ss_pred             CceEEEecCCCEEcCCCEEEEEcHHHHHhc
Confidence            355778999999999999999998888754


No 26 
>cd00210 PTS_IIA_glc PTS_IIA, PTS system, glucose/sucrose specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family is one of four structurally and functionally distinct group IIA PTS system cytoplasmic enzymes, necessary for the uptake of carbohydrates across the cytoplasmic membrane and their phosphorylation.
Probab=91.92  E-value=0.33  Score=32.52  Aligned_cols=31  Identities=23%  Similarity=0.381  Sum_probs=26.3

Q ss_pred             CCcEEEEecCcEEecCCeEEEEEeehhccCC
Q 042693           17 PGAISFRHYGAFLHKGNKLVTFIYEKLRSCD   47 (71)
Q Consensus        17 ~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~D   47 (71)
                      .|=..+++.||.|++|+.|+++-.+.++...
T Consensus        80 ~gF~~~vk~Gd~V~~G~~l~~~D~~~i~~~~  110 (124)
T cd00210          80 EGFTSHVEEGQRVKQGDKLLEFDLPAIKAAG  110 (124)
T ss_pred             CceEEEecCCCEEcCCCEEEEEcHHHHHhcC
Confidence            4666789999999999999999988887654


No 27 
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase. Members of this family are closely related to characterized examples of thymidine phosphorylase (EC 2.4.2.4) and pyrimidine nucleoside phosphorylase (RC 2.4.2.2). Most examples are found in the archaea, but other examples in Legionella pneumophila str. Paris and Rhodopseudomonas palustris CGA009.
Probab=91.22  E-value=0.39  Score=38.90  Aligned_cols=39  Identities=18%  Similarity=0.184  Sum_probs=33.1

Q ss_pred             CCCCCcEEEEE----------------eCCCcEEEEecCcEEecCCeEEEEEeeh
Q 042693            4 HLKSDQILIVQ----------------ATPGAISFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus         4 ~~~sGqii~i~----------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      .+++|.|..|.                -..|-.+|++-||.|++||+|+++..+.
T Consensus       418 A~~~G~v~~id~~~i~~~a~~~GAp~d~~aGi~l~~k~Gd~V~~Gd~l~~i~a~~  472 (493)
T TIGR02645       418 AETDGYVTEIDNKHITRIARLAGAPNDKGAGVELHVKVGDQVKKGDPLYTIYAES  472 (493)
T ss_pred             cCCCeEEEEeehHHHHHHHHHcCCCcCcCcCeEEeccCCCEecCCCeEEEEECCC
Confidence            56789988888                2358899999999999999999998654


No 28 
>TIGR03327 AMP_phos AMP phosphorylase. This enzyme family is found, so far, strictly in the Archaea, and only in those with a type III Rubisco enzyme. Most of the members previously were annotated as thymidine phosphorylase, or DeoA. The AMP metabolized by this enzyme may be produced by ADP-dependent sugar kinases.
Probab=90.89  E-value=0.39  Score=39.00  Aligned_cols=39  Identities=18%  Similarity=0.192  Sum_probs=33.3

Q ss_pred             CCCCCcEEEEE----------------eCCCcEEEEecCcEEecCCeEEEEEeeh
Q 042693            4 HLKSDQILIVQ----------------ATPGAISFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus         4 ~~~sGqii~i~----------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      .+.+|.|..|.                -..|-.+|.+-||.|++||+|+++..+.
T Consensus       419 A~~~G~v~~id~~~ig~~a~~lGA~id~~aGi~l~~k~Gd~V~~G~pl~~i~a~~  473 (500)
T TIGR03327       419 APTDGYVTDIDNKAITQIAREAGAPNDKGAGVYLHVKVGEKVKKGDPLYTIYAES  473 (500)
T ss_pred             CCCCeEEEEeehHHHHHHHHHcCCCcCcccCeEEeccCcCEeCCCCeEEEEECCC
Confidence            57789988888                3458899999999999999999998654


No 29 
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional
Probab=90.89  E-value=0.33  Score=35.79  Aligned_cols=34  Identities=15%  Similarity=0.246  Sum_probs=24.3

Q ss_pred             cEEEEEeCCCcE---EEEecCcEEecCCeEEEEEeeh
Q 042693            9 QILIVQATPGAI---SFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus         9 qii~i~~~~ga~---l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      +++.+..+.++.   ++|+.||.|++|++|++|--..
T Consensus        46 ~~v~i~~~v~G~V~~v~V~~Gd~VkkGqvLa~Ld~~~   82 (310)
T PRK10559         46 DVVAIAPDVSGLITQVNVHDNQLVKKGQVLFTIDQPR   82 (310)
T ss_pred             EEEEEccCCceEEEEEEeCCcCEEcCCCEEEEECcHH
Confidence            333444444443   4799999999999999997644


No 30 
>TIGR02644 Y_phosphoryl pyrimidine-nucleoside phosphorylase. In general, members of this protein family are designated pyrimidine-nucleoside phosphorylase, enzyme family EC 2.4.2.2, as in Bacillus subtilis, and more narrowly as the enzyme family EC 2.4.2.4, thymidine phosphorylase (alternate name: pyrimidine phosphorylase), as in Escherichia coli. The set of proteins encompassed by this model is designated subfamily rather than equivalog for this reason; the protein name from this model should be used when TIGR02643 does not score above trusted cutoff.
Probab=90.86  E-value=0.37  Score=37.98  Aligned_cols=39  Identities=23%  Similarity=0.264  Sum_probs=32.3

Q ss_pred             CCCCCcEEEEE-----------------------eCCCcEEEEecCcEEecCCeEEEEEeeh
Q 042693            4 HLKSDQILIVQ-----------------------ATPGAISFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus         4 ~~~sGqii~i~-----------------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      .+++|.|..|+                       -..|-.+|.+-|+.|++||+|+++.++.
T Consensus       338 a~~~G~v~~id~~~ig~~~~~lGagr~~~~d~id~~aGi~l~~k~G~~V~~g~~l~~i~~~~  399 (405)
T TIGR02644       338 AEKSGYISEIDAEELGLAAVDLGAGRARKEDKIDHEAGIYLHKKTGDRVKKGDPLATLYSSD  399 (405)
T ss_pred             CCCCeEEEEechHHHHHHHHHhCCCcCCCCCCCCcCCCeEEecCCcCEeCCCCeEEEEeCCC
Confidence            56788887777                       3458899999999999999999998653


No 31 
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase. This domain functions in transferring CO2 from one subsite to another, allowing carboxylation, decarboxylation, or transcarboxylation. During this process, biotin is covalently attached to a specific lysine.
Probab=90.86  E-value=0.51  Score=25.95  Aligned_cols=19  Identities=16%  Similarity=0.209  Sum_probs=15.1

Q ss_pred             EEEecCcEEecCCeEEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~   39 (71)
                      .+++.|+.|++|+.|+++-
T Consensus        13 ~~v~~G~~v~~g~~l~~i~   31 (67)
T cd06850          13 VLVKEGDKVEAGQPLAVLE   31 (67)
T ss_pred             EEeCCCCEECCCCEEEEEE
Confidence            4577788888999888774


No 32 
>PRK04350 thymidine phosphorylase; Provisional
Probab=90.81  E-value=0.44  Score=38.52  Aligned_cols=39  Identities=18%  Similarity=0.191  Sum_probs=33.2

Q ss_pred             CCCCCcEEEEE----------------eCCCcEEEEecCcEEecCCeEEEEEeeh
Q 042693            4 HLKSDQILIVQ----------------ATPGAISFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus         4 ~~~sGqii~i~----------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      .+.+|.|..|.                -..|-.+|++-||.|++||+|+++..+.
T Consensus       410 A~~~G~v~~id~~~ig~~a~~lGap~d~~aGi~l~~k~Gd~V~~G~~l~~i~a~~  464 (490)
T PRK04350        410 APRDGYVTAIDNRRLARIARLAGAPKDKGAGIDLHVKVGDKVKKGDPLYTIHAES  464 (490)
T ss_pred             CCCCeEEEEeehHHHHHHHHHcCCCcCcccCeEEeccCCCEecCCCeEEEEecCC
Confidence            57789998888                3358899999999999999999998654


No 33 
>PRK14898 DNA-directed RNA polymerase subunit A''; Provisional
Probab=90.78  E-value=0.25  Score=41.81  Aligned_cols=46  Identities=22%  Similarity=0.389  Sum_probs=36.1

Q ss_pred             CCcEEEE-ecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhcCC
Q 042693           17 PGAISFR-HYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        17 ~ga~l~v-~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~   64 (71)
                      +|.+-++ .||= |. ..+|=||.+....+-++|+|+||..|++-|++.
T Consensus       528 ~g~hnFi~Angi-v~-~~~LnTFH~AGv~~~nVTlGvPRL~EIinask~  574 (858)
T PRK14898        528 EGLETFTTADGV-VT-HNTMRTFHYAGVAEINVTLGLPRMIEIVDARKE  574 (858)
T ss_pred             cCcceeeeeCCE-ee-ccccceeeccCccccccccCCchHHHHhcccCC
Confidence            4666665 5542 22 356889999999899999999999999998866


No 34 
>PRK15136 multidrug efflux system protein EmrA; Provisional
Probab=90.71  E-value=0.39  Score=36.48  Aligned_cols=33  Identities=15%  Similarity=0.218  Sum_probs=23.5

Q ss_pred             cEEEEEeCCCcE---EEEecCcEEecCCeEEEEEee
Q 042693            9 QILIVQATPGAI---SFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus         9 qii~i~~~~ga~---l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      .++.+..+..+.   ++|++||.|++||+|++|--.
T Consensus        60 ~~v~v~a~v~G~V~~v~V~~Gd~VkkGqvL~~LD~~   95 (390)
T PRK15136         60 NQVQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPT   95 (390)
T ss_pred             eEEEEeccCCeEEEEEEcCCCCEECCCCEEEEECcH
Confidence            333444444433   479999999999999999754


No 35 
>PRK09439 PTS system glucose-specific transporter subunit; Provisional
Probab=90.66  E-value=0.48  Score=33.26  Aligned_cols=30  Identities=17%  Similarity=0.223  Sum_probs=25.9

Q ss_pred             CCcEEEEecCcEEecCCeEEEEEeehhccC
Q 042693           17 PGAISFRHYGAFLHKGNKLVTFIYEKLRSC   46 (71)
Q Consensus        17 ~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~   46 (71)
                      .|=..+++.||.|++||.|+++-.+.++..
T Consensus       102 ~gF~~~Vk~Gd~Vk~G~~L~~~D~~~i~~~  131 (169)
T PRK09439        102 EGFKRIAEEGQRVKVGDPIIEFDLPLLEEK  131 (169)
T ss_pred             CceEEEecCCCEEeCCCEEEEEcHHHHHhc
Confidence            356678999999999999999999888754


No 36 
>PRK05820 deoA thymidine phosphorylase; Reviewed
Probab=90.42  E-value=0.42  Score=38.07  Aligned_cols=39  Identities=15%  Similarity=0.176  Sum_probs=32.2

Q ss_pred             CCCCCcEEEEE-----------------------eCCCcEEEEecCcEEecCCeEEEEEeeh
Q 042693            4 HLKSDQILIVQ-----------------------ATPGAISFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus         4 ~~~sGqii~i~-----------------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      .+++|.|..|.                       -..|-.+|++-||.|++||+|+++.++.
T Consensus       345 A~~~G~v~~id~~~ig~~a~~lGaGR~~~~~~id~~aGi~l~~k~G~~V~~Gd~l~~i~~~~  406 (440)
T PRK05820        345 ADRSGVLSAMDTRALGMAVVRLGGGRRRKGDPIDYSVGLTLHARLGDRVDAGEPLATLHADD  406 (440)
T ss_pred             CCCCeEEEEecHHHHHHHHHHhCCCcCCCCCCCCcCCCeEEccCCcCEECCCCeEEEEeCCC
Confidence            46788887777                       3458899999999999999999998543


No 37 
>TIGR02643 T_phosphoryl thymidine phosphorylase. Thymidine phosphorylase (alternate name: pyrimidine phosphorylase), EC 2.4.2.4, is the designation for the enzyme of E. coli and other Proteobacteria involved in (deoxy)nucleotide degradation. It often occurs in an operon with a deoxyribose-phosphate aldolase, phosphopentomutase and a purine nucleoside phosphorylase. In many other lineages, the corresponding enzyme is designated pyrimidine-nucleoside phosphorylase (EC 2.4.2.2); the naming convention imposed by this model represents standard literature practice.
Probab=90.17  E-value=0.46  Score=37.92  Aligned_cols=39  Identities=13%  Similarity=0.126  Sum_probs=32.3

Q ss_pred             CCCCCcEEEEE-----------------------eCCCcEEEEecCcEEecCCeEEEEEeeh
Q 042693            4 HLKSDQILIVQ-----------------------ATPGAISFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus         4 ~~~sGqii~i~-----------------------~~~ga~l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      .+++|.|..|.                       -..|-.+|.+-||.|++||+|+++.++.
T Consensus       344 A~~~G~v~~id~~~ig~~~~~lGaGr~~~~d~iD~~aGi~l~~k~Gd~V~~Gd~l~~i~~~~  405 (437)
T TIGR02643       344 ADREGYVSEMDTRALGMAVVALGGGRRKADDTIDYSVGLTDLLPLGDRVEKGEPLAVVHAAD  405 (437)
T ss_pred             CCCCeEEEEeeHHHHHHHHHHcCccccCCCCCcCcccCeEeccCCcCEeCCCCeEEEEECCC
Confidence            46688887777                       3458899999999999999999998643


No 38 
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism]
Probab=90.12  E-value=0.71  Score=30.97  Aligned_cols=17  Identities=18%  Similarity=0.298  Sum_probs=10.4

Q ss_pred             EEecCcEEecCCeEEEE
Q 042693           22 FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l   38 (71)
                      ++++||.|..|++|+.+
T Consensus       122 lv~~G~~Ve~G~~L~~I  138 (140)
T COG0511         122 LVKNGDPVEYGDPLAVI  138 (140)
T ss_pred             EecCCCccCCCCEEEEe
Confidence            55666666666666654


No 39 
>PRK03598 putative efflux pump membrane fusion protein; Provisional
Probab=89.99  E-value=0.49  Score=34.55  Aligned_cols=21  Identities=14%  Similarity=-0.005  Sum_probs=18.8

Q ss_pred             EEEecCcEEecCCeEEEEEee
Q 042693           21 SFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      ++++.||.|++||+|++|--.
T Consensus        57 i~v~~Gd~V~kG~~L~~ld~~   77 (331)
T PRK03598         57 LAVDEGDAVKAGQVLGELDAA   77 (331)
T ss_pred             EEcCCCCEEcCCCEEEEEChH
Confidence            579999999999999999654


No 40 
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional
Probab=89.96  E-value=1.1  Score=26.29  Aligned_cols=20  Identities=25%  Similarity=0.257  Sum_probs=13.0

Q ss_pred             EEecCcEEecCCeEEEEEee
Q 042693           22 FRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~~e   41 (71)
                      +++.||.|++|++|+++--.
T Consensus        17 ~v~~Gd~V~~g~~l~~ve~~   36 (71)
T PRK05889         17 VVNEGDQIGKGDTLVLLESM   36 (71)
T ss_pred             EeCCCCEECCCCEEEEEEec
Confidence            56667777777777655433


No 41 
>PF00358 PTS_EIIA_1:  phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1;  InterPro: IPR001127 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred via a signal transduction pathway, to enzyme I (EI) which in turn transfers it to a phosphoryl carrier, the histidine protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease, a membrane-bound complex known as enzyme 2 (EII), which transports the sugar to the cell. EII consists of at least three structurally distinct domains IIA, IIB and IIC []. These can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII).  The first domain (IIA or EIIA) carries the first permease-specific phosphorylation site, a histidine which is phosphorylated by phospho-HPr. The second domain (IIB or EIIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the sugar transported. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate concomitantly with the sugar uptake processed by the IIC domain. This third domain (IIC or EIIC) forms the translocation channel and the specific substrate-binding site.  An additional transmembrane domain IID, homologous to IIC, can be found in some PTSs, e.g. for mannose [, , , ]. ; GO: 0005351 sugar:hydrogen symporter activity, 0006810 transport, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system, 0016020 membrane; PDB: 3OUR_D 1GPR_A 1F3G_A 2F3G_B 1F3Z_A 1O2F_A 1GLB_F 1GGR_A 1GLA_F 1GLE_F ....
Probab=89.10  E-value=0.28  Score=33.09  Aligned_cols=30  Identities=23%  Similarity=0.395  Sum_probs=22.7

Q ss_pred             CCcEEEEecCcEEecCCeEEEEEeehhccC
Q 042693           17 PGAISFRHYGAFLHKGNKLVTFIYEKLRSC   46 (71)
Q Consensus        17 ~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~   46 (71)
                      .|=..+++.||.|++|++|+++-.+.++..
T Consensus        84 ~gF~~~v~~G~~V~~G~~L~~~D~~~i~~~  113 (132)
T PF00358_consen   84 EGFETLVKEGDKVKAGQPLIEFDLEKIKEA  113 (132)
T ss_dssp             TTEEESS-TTSEE-TTEEEEEE-HHHHHHH
T ss_pred             cceEEEEeCCCEEECCCEEEEEcHHHHHhc
Confidence            355678899999999999999998888754


No 42 
>COG2190 NagE Phosphotransferase system IIA components [Carbohydrate transport and metabolism]
Probab=88.93  E-value=0.77  Score=32.24  Aligned_cols=29  Identities=21%  Similarity=0.326  Sum_probs=25.3

Q ss_pred             CcEEEEecCcEEecCCeEEEEEeehhccC
Q 042693           18 GAISFRHYGAFLHKGNKLVTFIYEKLRSC   46 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l~~e~~kt~   46 (71)
                      |=..+++.||.|++||.|+++-.+.+|..
T Consensus        88 gF~~~v~~Gd~Vk~Gd~Li~fDl~~Ik~~  116 (156)
T COG2190          88 GFESLVKEGDKVKAGDPLLEFDLDLIKAK  116 (156)
T ss_pred             ceEEEeeCCCEEccCCEEEEECHHHHhhc
Confidence            55678999999999999999998887765


No 43 
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family. Type I secretion is an ABC transport process that exports proteins, without cleavage of any signal sequence, from the cytosol to extracellular medium across both inner and outer membranes. The secretion signal is found in the C-terminus of the transported protein. This model represents the adaptor protein between the ATP-binding cassette (ABC) protein of the inner membrane and the outer membrane protein, and is called the membrane fusion protein. This model selects a subfamily closely related to HlyD; it is defined narrowly and excludes, for example, colicin V secretion protein CvaA and multidrug efflux proteins.
Probab=88.88  E-value=0.72  Score=33.79  Aligned_cols=24  Identities=17%  Similarity=0.178  Sum_probs=21.0

Q ss_pred             EEEecCcEEecCCeEEEEEeehhc
Q 042693           21 SFRHYGAFLHKGNKLVTFIYEKLR   44 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e~~k   44 (71)
                      ++|++||.|++|++|+++-...+.
T Consensus        57 i~V~eG~~V~kG~~L~~ld~~~~~   80 (423)
T TIGR01843        57 ILVREGDRVKAGQVLVELDATDVE   80 (423)
T ss_pred             EEeCCCCEecCCCeEEEEccchhh
Confidence            589999999999999999876653


No 44 
>CHL00117 rpoC2 RNA polymerase beta'' subunit; Reviewed
Probab=88.84  E-value=0.8  Score=41.09  Aligned_cols=27  Identities=4%  Similarity=0.142  Sum_probs=25.1

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEEee
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      +|.||.|+|++|+.|++|++||...--
T Consensus       400 ip~gs~l~v~~g~~V~~~q~iae~~~~  426 (1364)
T CHL00117        400 IPPKSLLLVQNDQYVESEQVIAEIRAG  426 (1364)
T ss_pred             eCCCCEEEEeCcCEEcCCCEEEEECCC
Confidence            999999999999999999999988753


No 45 
>cd02735 RNAP_I_Rpa1_C Largest subunit (Rpa1) of Eukaryotic RNA polymerase I (RNAP I), C-terminal domain. RNA polymerase I (RNAP I) is a multi-subunit protein complex responsible for the synthesis of rRNA precursor. It consists of at least 14 different subunits, and the largest one is homologous to subunit Rpb1 of yeast RNAP II and subunit beta' of bacterial RNAP. Rpa1 is also known as Rpa190 in yeast. Structure studies suggest that different RNAP complexes share a similar crab-claw-shape structure. The C-terminal domain of Rpb1, the largest subunit of RNAP II, makes up part of the foot and jaw structures of RNAP II. The similarity between this domain and the C-terminal domain of Rpb1, its counterpart in RNAP II, suggests a similar functional and structural role.
Probab=87.94  E-value=0.27  Score=37.17  Aligned_cols=32  Identities=16%  Similarity=0.283  Sum_probs=26.7

Q ss_pred             CeEEEEEeehhccCCccCchhhHhhhh-hhcCC
Q 042693           33 NKLVTFIYEKLRSCDLTRALSKVKQVL-EIRSF   64 (71)
Q Consensus        33 ~~L~~l~~e~~kt~DItqGLPkVeeLf-EAR~~   64 (71)
                      -+|=||.+....+.++|+|+||..|++ -|++.
T Consensus        28 MTLnTFH~AGv~~~nVTlGvPRL~EIi~~Ask~   60 (309)
T cd02735          28 MTLNTFHFAGRGEMNVTLGIPRLREILMTASKN   60 (309)
T ss_pred             cccccccccCccccccccccccHHHHHhhhccC
Confidence            357788888888899999999999998 66543


No 46 
>PRK10476 multidrug resistance protein MdtN; Provisional
Probab=87.69  E-value=0.52  Score=34.70  Aligned_cols=29  Identities=14%  Similarity=0.031  Sum_probs=22.5

Q ss_pred             eCCCcE---EEEecCcEEecCCeEEEEEeehh
Q 042693           15 ATPGAI---SFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        15 ~~~ga~---l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      .+.++.   ++|+.||.|++|++|++|-....
T Consensus        53 ~~v~G~V~~v~V~~G~~VkkGq~L~~ld~~~~   84 (346)
T PRK10476         53 SEVGGRIVELAVTENQAVKKGDLLFRIDPRPY   84 (346)
T ss_pred             ccCceEEEEEEeCCCCEEcCCCEEEEECcHHH
Confidence            444444   47999999999999999986543


No 47 
>PF06898 YqfD:  Putative stage IV sporulation protein YqfD;  InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins. YqfD of Bacillus subtilis (P54469 from SWISSPROT) is known to be essential for efficient sporulation although its exact function is unknown [].
Probab=87.37  E-value=1.1  Score=34.41  Aligned_cols=36  Identities=19%  Similarity=0.282  Sum_probs=27.7

Q ss_pred             CCCCCcEEEEEeCCCcEEEEecCcEEecCCeEEEEEe
Q 042693            4 HLKSDQILIVQATPGAISFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus         4 ~~~sGqii~i~~~~ga~l~v~~G~~V~~G~~L~~l~~   40 (71)
                      +.++|.|.++.+-.| ...|+.||.|++||+|+.=.-
T Consensus       194 A~kdGvI~~i~v~~G-~p~Vk~Gd~VkkGdvLISG~i  229 (385)
T PF06898_consen  194 AKKDGVITSIIVRSG-TPLVKVGDTVKKGDVLISGVI  229 (385)
T ss_pred             ECCCCEEEEEEecCC-eEEecCCCEECCCCEEEeeeE
Confidence            456777777766555 778999999999999986543


No 48 
>PF01333 Apocytochr_F_C:  Apocytochrome F, C-terminal;  InterPro: IPR002325 The cytochrome b6f integral membrane protein complex transfers electrons between the two reaction centre complexes of oxygenic photosynthetic membranes, and participates in formation of the transmembrane electrochemical proton gradient by also transferring protons from the stromal to the internal lumen compartment []. The cytochrome b6f complex contains four polypeptides: cytochrome f (285 aa); cytochrome b6 (215 aa); Rieske iron-sulphur protein (179 aa); and subunit IV (160 aa) []. In its structure and functions, the cytochrome b6f complex bears extensive analogy to the cytochrome bc1 complex of mitochondria and photosynthetic purple bacteria; cytochrome f (cyt f) plays a role analogous to that of cytochrome c1, in spite of their different structures [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding, 0015979 photosynthesis, 0031361 integral to thylakoid membrane; PDB: 2E75_C 2E74_C 1VF5_P 2D2C_P 2E76_C 1TU2_B 2ZT9_C 1E2V_A 1CFM_A 1E2W_B ....
Probab=87.07  E-value=0.29  Score=33.26  Aligned_cols=25  Identities=12%  Similarity=0.034  Sum_probs=16.2

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEE
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      +|+|-.|.|+.||.|+.|++|-.=|
T Consensus        40 IP~GpeLiV~eG~~V~~dqpLT~nP   64 (118)
T PF01333_consen   40 IPAGPELIVSEGQSVKADQPLTNNP   64 (118)
T ss_dssp             EESSS-BS--TT-EETTT-BSB---
T ss_pred             cCCCCeEEEcCCCEEecCCcccCCC
Confidence            9999999999999999999986544


No 49 
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=87.05  E-value=1.7  Score=29.28  Aligned_cols=20  Identities=10%  Similarity=0.091  Sum_probs=13.8

Q ss_pred             EEecCcEEecCCeEEEEEee
Q 042693           22 FRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~~e   41 (71)
                      +++.||.|++|++|+.+--.
T Consensus        76 ~V~~Gd~V~~Gq~L~~lEam   95 (130)
T PRK06549         76 LVAVGDQVTENQPLLILEAM   95 (130)
T ss_pred             EeCCCCEECCCCEEEEEecc
Confidence            56777777777777766443


No 50 
>PRK06078 pyrimidine-nucleoside phosphorylase; Reviewed
Probab=86.50  E-value=1.2  Score=35.58  Aligned_cols=36  Identities=22%  Similarity=0.237  Sum_probs=31.0

Q ss_pred             CCCCCcEEEEE-----------------------eCCCcEEEEecCcEEecCCeEEEEE
Q 042693            4 HLKSDQILIVQ-----------------------ATPGAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus         4 ~~~sGqii~i~-----------------------~~~ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      .+++|.|..|.                       -..|-.+|.+-||.|++||+|+++.
T Consensus       340 a~~~G~v~~id~~~ig~~~~~lGagr~~~~d~id~~aGi~l~~k~g~~V~~g~~l~~i~  398 (434)
T PRK06078        340 AKESGYISELVADEIGLAAMLLGAGRATKEDEIDLAVGIVLRKKVGDSVKKGESLATIY  398 (434)
T ss_pred             CCCCeEEEEeeHHHHHHHHHHcCCCCCCCCCccCcccCeEeccCCcCEeCCCCeEEEEe
Confidence            56788888887                       3458899999999999999999997


No 51 
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional
Probab=86.04  E-value=1.3  Score=25.97  Aligned_cols=35  Identities=14%  Similarity=0.181  Sum_probs=23.8

Q ss_pred             CCCCCcEEEEEeCCCc------E-----------------------EEEecCcEEecCCeEEEE
Q 042693            4 HLKSDQILIVQATPGA------I-----------------------SFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus         4 ~~~sGqii~i~~~~ga------~-----------------------l~v~~G~~V~~G~~L~~l   38 (71)
                      .|.+|.|.++++..|.      .                       ++++.|+.|+.|++|+.+
T Consensus         7 a~~~G~i~~~~v~~Gd~V~~g~~l~~ve~~K~~~~I~a~~~G~V~~i~v~~G~~V~~G~~l~~i   70 (71)
T PRK05889          7 AEIVASVLEVVVNEGDQIGKGDTLVLLESMKMEIPVLAEVAGTVSKVSVSVGDVIQAGDLIAVI   70 (71)
T ss_pred             CCCCEEEEEEEeCCCCEECCCCEEEEEEeccceeEEeCCCCEEEEEEEeCCCCEECCCCEEEEE
Confidence            5778888888844433      2                       346677777777777765


No 52 
>TIGR02876 spore_yqfD sporulation protein YqfD. YqfD is part of the sigma-E regulon in the sporulation program of endospore-forming Gram-positive bacteria. Mutation results in a sporulation defect in Bacillus subtilis. Members are found in all currently known endospore-forming bacteria, including the genera Bacillus, Symbiobacterium, Carboxydothermus, Clostridium, and Thermoanaerobacter.
Probab=85.72  E-value=1.5  Score=33.79  Aligned_cols=34  Identities=26%  Similarity=0.262  Sum_probs=26.8

Q ss_pred             CCCCCcEEEEEeCCCcEEEEecCcEEecCCeEEEE
Q 042693            4 HLKSDQILIVQATPGAISFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus         4 ~~~sGqii~i~~~~ga~l~v~~G~~V~~G~~L~~l   38 (71)
                      +.++|.|..+.+..| .-.|+.||.|++||+|+.=
T Consensus       191 A~kdGvI~~i~v~~G-~p~Vk~GD~VkkGqvLIsG  224 (382)
T TIGR02876       191 AKKDGVIKRVYVTSG-EPVVKKGDVVKKGDLLISG  224 (382)
T ss_pred             ECCCCEEEEEEEcCC-eEEEccCCEEcCCCEEEEe
Confidence            346677777766666 7789999999999999863


No 53 
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=85.45  E-value=1.2  Score=25.83  Aligned_cols=18  Identities=22%  Similarity=0.425  Sum_probs=14.8

Q ss_pred             EEEecCcEEecCCeEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l   38 (71)
                      ++++.|+.|..|++|+.+
T Consensus        52 ~~~~~G~~V~~g~~l~~i   69 (70)
T PRK08225         52 INVQEGDFVNEGDVLLEI   69 (70)
T ss_pred             EEecCCCEECCCCEEEEE
Confidence            468888899999888875


No 54 
>PF12700 HlyD_2:  HlyD family secretion protein; PDB: 3LNN_B 4DK0_A 4DK1_C 3FPP_B 2K32_A 2K33_A 3OW7_B 3OOC_A 3T53_B 4DNT_C ....
Probab=85.06  E-value=0.73  Score=32.50  Aligned_cols=24  Identities=21%  Similarity=0.130  Sum_probs=16.7

Q ss_pred             EEEEecCcEEecCCeEEEEEeehh
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      .++++.|+.|++|++|+++-...+
T Consensus        33 ~~~v~~G~~V~kG~~L~~ld~~~~   56 (328)
T PF12700_consen   33 SVNVKEGDKVKKGQVLAELDSSDL   56 (328)
T ss_dssp             EE-S-TTSEEETT-EEEEEE-HHH
T ss_pred             EEEeCCcCEECCCCEEEEEEChhh
Confidence            347889999999999999976544


No 55 
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane.
Probab=84.19  E-value=0.96  Score=31.83  Aligned_cols=28  Identities=18%  Similarity=0.092  Sum_probs=22.2

Q ss_pred             eCCCcEE---EEecCcEEecCCeEEEEEeeh
Q 042693           15 ATPGAIS---FRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        15 ~~~ga~l---~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      .|..+.+   +++.|+.|++|++|+++-...
T Consensus        31 a~~~G~V~~i~v~~G~~V~kG~~L~~l~~~~   61 (322)
T TIGR01730        31 AEVAGKITKISVREGQKVKKGQVLARLDDDD   61 (322)
T ss_pred             ccccEEEEEEEcCCCCEEcCCCEEEEECCHH
Confidence            5665664   589999999999999996443


No 56 
>PF00364 Biotin_lipoyl:  Biotin-requiring enzyme;  InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid. Biotin plays a catalytic role in some carboxyl transfer reactions and is covalently attached, via an amide bond, to a lysine residue in enzymes requiring this coenzyme []. E2 acyltransferases have an essential cofactor, lipoic acid, which is covalently bound via an amide linkage to a lysine group []. The lipoic acid cofactor is found in a variety of proteins that include, H-protein of the glycine cleavage system (GCS), mammalian and yeast pyruvate dehydrogenases and fast migrating protein (FMP) (gene acoC) from Ralstonia eutropha (Alcaligenes eutrophus).; PDB: 2EJG_D 2D5D_A 2EJF_C 2EVB_A 1IYV_A 1IYU_A 1LAC_A 1LAB_A 1DCZ_A 1DD2_A ....
Probab=83.63  E-value=0.74  Score=27.32  Aligned_cols=24  Identities=21%  Similarity=0.189  Sum_probs=19.4

Q ss_pred             EEEEecCcEEecCCeEEEEEeehh
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      ..+++.|+.|++||+|+.+--.+.
T Consensus        19 ~~~v~~G~~V~~G~~l~~iet~K~   42 (74)
T PF00364_consen   19 KWLVEEGDKVKKGDPLAEIETMKM   42 (74)
T ss_dssp             EESSSTTEEESTTSEEEEEESSSE
T ss_pred             EEEECCCCEEEcCceEEEEEcCcc
Confidence            367899999999999998865443


No 57 
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=83.27  E-value=2.9  Score=28.81  Aligned_cols=21  Identities=19%  Similarity=0.194  Sum_probs=15.8

Q ss_pred             EEecCcEEecCCeEEEEEeeh
Q 042693           22 FRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      +++.||.|++||.|+.+--.+
T Consensus        99 ~V~~Gd~V~~Gq~l~~iEamK  119 (153)
T PRK05641         99 LVREGQQVKVGQGLLILEAMK  119 (153)
T ss_pred             EeCCCCEEcCCCEEEEEeecc
Confidence            578888888888888765444


No 58 
>PRK14977 bifunctional DNA-directed RNA polymerase A'/A'' subunit; Provisional
Probab=83.15  E-value=0.55  Score=41.85  Aligned_cols=31  Identities=23%  Similarity=0.394  Sum_probs=26.5

Q ss_pred             eEEEEEeehhccCCccCchhhHhhhhhhcCC
Q 042693           34 KLVTFIYEKLRSCDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        34 ~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~   64 (71)
                      +|=|+.+....+.++|+|+||+.|++-||+.
T Consensus       997 TLnTFH~AGv~~~nvt~GvpRl~Eii~a~k~ 1027 (1321)
T PRK14977        997 TLRTFHAAGIKAMDVTHGLERFIELVDARAK 1027 (1321)
T ss_pred             cccccccccccccCcccCccchHHhhhcccC
Confidence            4567778777788999999999999999875


No 59 
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=82.87  E-value=1.6  Score=25.26  Aligned_cols=22  Identities=18%  Similarity=0.218  Sum_probs=18.1

Q ss_pred             EEEecCcEEecCCeEEEEEeeh
Q 042693           21 SFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      ++++.|+.|++|++|+++--.+
T Consensus        15 ~~v~~G~~V~~g~~l~~ve~~k   36 (70)
T PRK08225         15 IVVKVGDTVEEGQDVVILESMK   36 (70)
T ss_pred             EEeCCCCEECCCCEEEEEEcCC
Confidence            4688899999999999865444


No 60 
>PF00364 Biotin_lipoyl:  Biotin-requiring enzyme;  InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid. Biotin plays a catalytic role in some carboxyl transfer reactions and is covalently attached, via an amide bond, to a lysine residue in enzymes requiring this coenzyme []. E2 acyltransferases have an essential cofactor, lipoic acid, which is covalently bound via an amide linkage to a lysine group []. The lipoic acid cofactor is found in a variety of proteins that include, H-protein of the glycine cleavage system (GCS), mammalian and yeast pyruvate dehydrogenases and fast migrating protein (FMP) (gene acoC) from Ralstonia eutropha (Alcaligenes eutrophus).; PDB: 2EJG_D 2D5D_A 2EJF_C 2EVB_A 1IYV_A 1IYU_A 1LAC_A 1LAB_A 1DCZ_A 1DD2_A ....
Probab=82.79  E-value=2.6  Score=24.92  Aligned_cols=24  Identities=21%  Similarity=0.227  Sum_probs=19.0

Q ss_pred             eCCCcEE---EEecCcEEecCCeEEEE
Q 042693           15 ATPGAIS---FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        15 ~~~ga~l---~v~~G~~V~~G~~L~~l   38 (71)
                      +|..+++   +++.|+.|..|++|+++
T Consensus        48 a~~~G~i~~i~v~~G~~V~~G~~l~~I   74 (74)
T PF00364_consen   48 APVSGIIKEILVEEGDTVEVGQVLAII   74 (74)
T ss_dssp             BSSSEEEEEESSTTTEEEETTSEEEEE
T ss_pred             CCCCEEEEEEEECCCCEECCCCEEEEC
Confidence            6655554   57789999999999975


No 61 
>PRK11578 macrolide transporter subunit MacA; Provisional
Probab=82.60  E-value=1.3  Score=32.94  Aligned_cols=21  Identities=19%  Similarity=-0.040  Sum_probs=18.5

Q ss_pred             EEEecCcEEecCCeEEEEEee
Q 042693           21 SFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      ++++.|+.|++|++|+++-..
T Consensus        75 v~v~~G~~V~kG~~L~~ld~~   95 (370)
T PRK11578         75 LSVAIGDKVKKDQLLGVIDPE   95 (370)
T ss_pred             EEcCCCCEEcCCCEEEEECcH
Confidence            478999999999999999654


No 62 
>PRK11556 multidrug efflux system subunit MdtA; Provisional
Probab=82.43  E-value=1.2  Score=34.05  Aligned_cols=20  Identities=15%  Similarity=0.064  Sum_probs=18.1

Q ss_pred             EEEecCcEEecCCeEEEEEe
Q 042693           21 SFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~   40 (71)
                      ++++.|+.|++|++|++|--
T Consensus       101 i~v~eG~~VkkGq~La~ld~  120 (415)
T PRK11556        101 LHFQEGQQVKAGDLLAEIDP  120 (415)
T ss_pred             EECCCCCEecCCCEEEEECc
Confidence            57999999999999999964


No 63 
>COG0845 AcrA Membrane-fusion protein [Cell envelope biogenesis, outer membrane]
Probab=82.41  E-value=1.3  Score=30.55  Aligned_cols=21  Identities=19%  Similarity=0.102  Sum_probs=19.1

Q ss_pred             EEEEecCcEEecCCeEEEEEe
Q 042693           20 ISFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~   40 (71)
                      .++|++||.|++|+.|+.+--
T Consensus        79 ~i~v~~G~~Vk~Gq~L~~ld~   99 (372)
T COG0845          79 EILVKEGDRVKKGQLLARLDP   99 (372)
T ss_pred             EEEccCCCeecCCCEEEEECC
Confidence            468999999999999999876


No 64 
>PRK09824 PTS system beta-glucoside-specific transporter subunits IIABC; Provisional
Probab=82.18  E-value=2.1  Score=35.47  Aligned_cols=30  Identities=17%  Similarity=0.224  Sum_probs=26.4

Q ss_pred             CCcEEEEecCcEEecCCeEEEEEeehhccC
Q 042693           17 PGAISFRHYGAFLHKGNKLVTFIYEKLRSC   46 (71)
Q Consensus        17 ~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~   46 (71)
                      .|=..+++.||.|++||.|+++-.+.++..
T Consensus       560 ~gF~~~v~~Gd~V~~G~~l~~~D~~~i~~~  589 (627)
T PRK09824        560 KFFTAHVNVGDKVNTGDLLIEFDIPAIREA  589 (627)
T ss_pred             CCceEEecCCCEEcCCCEEEEEcHHHHHhc
Confidence            466789999999999999999999988864


No 65 
>PRK07051 hypothetical protein; Validated
Probab=82.16  E-value=1.7  Score=26.19  Aligned_cols=18  Identities=17%  Similarity=0.185  Sum_probs=15.7

Q ss_pred             EEEecCcEEecCCeEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l   38 (71)
                      +++++|+.|..|++|+++
T Consensus        61 i~~~~G~~V~~G~~l~~i   78 (80)
T PRK07051         61 FLVEDGEPVEAGQVLARI   78 (80)
T ss_pred             EEcCCcCEECCCCEEEEE
Confidence            568899999999999987


No 66 
>TIGR01995 PTS-II-ABC-beta PTS system, beta-glucoside-specific IIABC component. This model represents a family of PTS enzyme II proteins in which all three domains are found in the same polypeptide chain and which appear to have a broad specificity for beta-glucosides including salicin (beta-D-glucose-1-salicylate) and arbutin (Hydroquinone-O-beta-D-glucopyranoside). These are distinct from the closely related sucrose-specific and trehalose-specific PTS transporters.
Probab=81.72  E-value=2.3  Score=34.76  Aligned_cols=30  Identities=23%  Similarity=0.399  Sum_probs=26.4

Q ss_pred             CCcEEEEecCcEEecCCeEEEEEeehhccC
Q 042693           17 PGAISFRHYGAFLHKGNKLVTFIYEKLRSC   46 (71)
Q Consensus        17 ~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~   46 (71)
                      .|=..+++.||.|++||.|+++-.+.+|..
T Consensus       544 ~gF~~~v~~g~~V~~G~~l~~~d~~~i~~~  573 (610)
T TIGR01995       544 EGFEILVKVGDHVKAGQLLLTFDLDKIKEA  573 (610)
T ss_pred             CCeEEEecCcCEEcCCCEEEEecHHHHHhc
Confidence            355778999999999999999999998865


No 67 
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed
Probab=81.55  E-value=1.3  Score=33.16  Aligned_cols=22  Identities=14%  Similarity=0.031  Sum_probs=18.9

Q ss_pred             EEEecCcEEecCCeEEEEEeeh
Q 042693           21 SFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      ++++.||.|++|++|++|--..
T Consensus        77 v~v~~Gd~VkkGq~La~ld~~~   98 (385)
T PRK09578         77 RTYEEGQEVKQGAVLFRIDPAP   98 (385)
T ss_pred             EECCCCCEEcCCCEEEEECCHH
Confidence            4799999999999999996543


No 68 
>PRK14844 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Provisional
Probab=81.16  E-value=2.7  Score=40.46  Aligned_cols=40  Identities=20%  Similarity=0.231  Sum_probs=31.6

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEE----------eehhccCCccCchhh
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFI----------YEKLRSCDLTRALSK   54 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~----------~e~~kt~DItqGLPk   54 (71)
                      +|-||+|+|++|+.|++|++|+..-          ....+..||+.|.-=
T Consensus      2418 i~yga~l~v~~g~~V~~g~~la~wdp~~~piisE~~G~v~f~d~~~g~t~ 2467 (2836)
T PRK14844       2418 VPYGAKLYVDEGGSVKIGDKVAEWDPYTLPIITEKTGTVSYQDLKDGISI 2467 (2836)
T ss_pred             cccccEEEecCCCEecCCCEEEEEcCCCcceEeecceEEEEEEEecceeE
Confidence            9999999999999999999999753          234456677776543


No 69 
>PRK09859 multidrug efflux system protein MdtE; Provisional
Probab=80.38  E-value=1.5  Score=32.83  Aligned_cols=21  Identities=14%  Similarity=0.034  Sum_probs=18.7

Q ss_pred             EEEecCcEEecCCeEEEEEee
Q 042693           21 SFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      ++++.|+.|++|++|++|--.
T Consensus        75 i~v~~G~~VkkGqvLa~ld~~   95 (385)
T PRK09859         75 RNFIEGDKVNQGDSLYQIDPA   95 (385)
T ss_pred             EEcCCcCEecCCCEEEEECcH
Confidence            479999999999999999754


No 70 
>COG0213 DeoA Thymidine phosphorylase [Nucleotide transport and metabolism]
Probab=80.38  E-value=2.9  Score=33.71  Aligned_cols=25  Identities=28%  Similarity=0.426  Sum_probs=22.8

Q ss_pred             CCcEEEEecCcEEecCCeEEEEEee
Q 042693           17 PGAISFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        17 ~ga~l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      .|-.+|.+-|+.|++||+|+++..+
T Consensus       377 aGi~l~kk~ge~Vk~Gd~l~tiya~  401 (435)
T COG0213         377 AGIYLHKKLGEKVKKGDPLATIYAE  401 (435)
T ss_pred             cceEEEecCCCeeccCCeEEEEecC
Confidence            5889999999999999999999874


No 71 
>PRK10255 PTS system N-acetyl glucosamine specific transporter subunits IIABC; Provisional
Probab=80.35  E-value=2.6  Score=35.14  Aligned_cols=30  Identities=17%  Similarity=0.223  Sum_probs=26.4

Q ss_pred             CCcEEEEecCcEEecCCeEEEEEeehhccC
Q 042693           17 PGAISFRHYGAFLHKGNKLVTFIYEKLRSC   46 (71)
Q Consensus        17 ~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~   46 (71)
                      .|=..+|+.||.|++||.|+++-.+.++..
T Consensus       580 ~gF~~~Vk~Gd~V~~G~~l~~~D~~~i~~~  609 (648)
T PRK10255        580 KGFKRLVEEGAQVSAGQPILEMDLDYLNAN  609 (648)
T ss_pred             CCceEEecCCCEEcCCCEEEEEcHHHHHhc
Confidence            466778999999999999999999988764


No 72 
>PRK06748 hypothetical protein; Validated
Probab=80.32  E-value=2.3  Score=26.82  Aligned_cols=20  Identities=15%  Similarity=0.127  Sum_probs=17.2

Q ss_pred             EEEecCcEEecCCeEEEEEe
Q 042693           21 SFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~   40 (71)
                      .+++.||.|++|++|+.+--
T Consensus        18 w~vk~GD~V~~gd~l~~IET   37 (83)
T PRK06748         18 LFVRESSYVYEWEKLALIET   37 (83)
T ss_pred             EEeCCCCEECCCCEEEEEEc
Confidence            47889999999999998866


No 73 
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism]
Probab=80.30  E-value=1.9  Score=28.89  Aligned_cols=19  Identities=21%  Similarity=0.352  Sum_probs=16.8

Q ss_pred             EEEecCcEEecCCeEEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~   39 (71)
                      ++|+.||.|++|++|+.+=
T Consensus        84 ~~V~vGd~V~~Gq~l~IiE  102 (140)
T COG0511          84 PFVEVGDTVKAGQTLAIIE  102 (140)
T ss_pred             EeeccCCEEcCCCEEEEEE
Confidence            4799999999999999763


No 74 
>CHL00037 petA cytochrome f
Probab=79.21  E-value=3.2  Score=32.34  Aligned_cols=25  Identities=16%  Similarity=0.138  Sum_probs=22.6

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEE
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      +|+|..|.|+.||.|+.|++|-.=|
T Consensus       242 iP~Gp~LiVs~G~~v~~~qpLTnnP  266 (320)
T CHL00037        242 IPPGPELLVSEGESIKLDQPLTNNP  266 (320)
T ss_pred             eCCCCeEEEecCceEecCCcccCCC
Confidence            8999999999999999999986554


No 75 
>PRK15030 multidrug efflux system transporter AcrA; Provisional
Probab=78.79  E-value=1.8  Score=32.74  Aligned_cols=21  Identities=14%  Similarity=-0.015  Sum_probs=18.5

Q ss_pred             EEEecCcEEecCCeEEEEEee
Q 042693           21 SFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      ++++.||.|++|++|++|--.
T Consensus        79 v~v~~Gd~VkkGqvLa~ld~~   99 (397)
T PRK15030         79 RNFKEGSDIEAGVSLYQIDPA   99 (397)
T ss_pred             EEcCCCCEecCCCEEEEECCH
Confidence            479999999999999999643


No 76 
>PRK02693 apocytochrome f; Reviewed
Probab=78.12  E-value=3.6  Score=31.92  Aligned_cols=25  Identities=16%  Similarity=0.137  Sum_probs=22.8

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEE
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      +|+|..|.|+.||.|+.|++|-.=|
T Consensus       234 iP~GpeliV~eG~~v~~dqpLTnnP  258 (312)
T PRK02693        234 IPAGPELIVKEGDTVEAGDPLTNDP  258 (312)
T ss_pred             cCCCCeEEEecCcEEecCCcccCCC
Confidence            9999999999999999999987654


No 77 
>PRK02597 rpoC2 DNA-directed RNA polymerase subunit beta'; Provisional
Probab=77.52  E-value=4.9  Score=36.33  Aligned_cols=32  Identities=16%  Similarity=0.169  Sum_probs=27.7

Q ss_pred             EEEEEeCCCcEEEEecCcEEecCCeEEEEEee
Q 042693           10 ILIVQATPGAISFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        10 ii~i~~~~ga~l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      ...+.+|+++.|+|++|+.|+++.+||.+...
T Consensus       394 ~~~~~ip~~s~l~v~~~q~v~~~q~iae~~~~  425 (1331)
T PRK02597        394 PQKIEITQGSLLFVDDGQTVEADQLLAEVAAG  425 (1331)
T ss_pred             eEEEEeCCCCEEEEECCcEEecCcEEEEeecC
Confidence            33444999999999999999999999998864


No 78 
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein. The gene name is accB or fabE.
Probab=77.46  E-value=2.1  Score=29.29  Aligned_cols=28  Identities=29%  Similarity=0.354  Sum_probs=22.0

Q ss_pred             CCCcEEEEecCcEEecCCeEEEEEeehh
Q 042693           16 TPGAISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        16 ~~ga~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      ++++-.+++.||.|++|++|+.+--.+.
T Consensus        96 ~P~~~~~v~~Gd~V~~Gq~l~iiEamK~  123 (156)
T TIGR00531        96 SPDAKPFVEVGDKVKKGQIVCIVEAMKL  123 (156)
T ss_pred             CCCCCccccCCCEeCCCCEEEEEEeccc
Confidence            4566678999999999999987754443


No 79 
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=76.85  E-value=2.1  Score=29.15  Aligned_cols=29  Identities=24%  Similarity=0.365  Sum_probs=23.5

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEEeehh
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      -++++-.+++.||.|++|++|+.+--.+.
T Consensus        94 ~sP~~~~~v~~Gd~V~~Gq~l~~iEamK~  122 (155)
T PRK06302         94 PSPDAPPFVEVGDTVKEGQTLCIIEAMKV  122 (155)
T ss_pred             CCCCCCcccCCCCEeCCCCEEEEEEeccc
Confidence            34677778999999999999998765554


No 80 
>PF02749 QRPTase_N:  Quinolinate phosphoribosyl transferase, N-terminal domain;  InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2.4.2.19 from EC is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to give rise to nicotinic acid mononucleotide (NaMN), pyrophosphate and carbon dioxide [, ]. Unlike IPR004393 from INTERPRO, this domain also includes the molybdenum transport system protein ModD.; GO: 0016763 transferase activity, transferring pentosyl groups; PDB: 3L0G_B 1QAP_A 3C2O_A 3C2F_A 3C2E_A 3C2R_A 3C2V_A 2I14_C 1X1O_B 2B7Q_B ....
Probab=76.61  E-value=2.1  Score=26.28  Aligned_cols=21  Identities=10%  Similarity=0.105  Sum_probs=16.0

Q ss_pred             cEEEEecCcEEecCCeEEEEE
Q 042693           19 AISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        19 a~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...++++|+.|.+|++|+++.
T Consensus        47 v~~~~~dG~~v~~g~~i~~i~   67 (88)
T PF02749_consen   47 VEWLVKDGDRVEPGDVILEIE   67 (88)
T ss_dssp             EEESS-TT-EEETTCEEEEEE
T ss_pred             EEEEeCCCCCccCCcEEEEEE
Confidence            345789999999999999875


No 81 
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms]
Probab=75.91  E-value=2.9  Score=32.43  Aligned_cols=21  Identities=14%  Similarity=0.033  Sum_probs=18.4

Q ss_pred             EEEEecCcEEecCCeEEEEEe
Q 042693           20 ISFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~   40 (71)
                      -+.|++++.|++||+|++|--
T Consensus        66 eV~V~dnq~Vk~Gd~L~~iD~   86 (352)
T COG1566          66 EVNVKDNQLVKKGDVLFRIDP   86 (352)
T ss_pred             EEEecCCCEecCCCeEEEECc
Confidence            457999999999999999864


No 82 
>PRK07051 hypothetical protein; Validated
Probab=74.27  E-value=4  Score=24.49  Aligned_cols=25  Identities=16%  Similarity=0.135  Sum_probs=20.5

Q ss_pred             CcEEEEecCcEEecCCeEEEEEeeh
Q 042693           18 GAISFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      +.-++++.|+.|++|++++++--.+
T Consensus        21 ~~~~~v~~Gd~V~~g~~l~~ve~~k   45 (80)
T PRK07051         21 DAPPYVEVGDAVAAGDVVGLIEVMK   45 (80)
T ss_pred             CCCCccCCCCEECCCCEEEEEEEcc
Confidence            4557799999999999999976543


No 83 
>KOG0261 consensus RNA polymerase III, large subunit [Transcription]
Probab=73.23  E-value=2.4  Score=37.91  Aligned_cols=32  Identities=19%  Similarity=0.380  Sum_probs=28.7

Q ss_pred             CeEEEEEeehhccCCccCchhhHhhhhhhcCC
Q 042693           33 NKLVTFIYEKLRSCDLTRALSKVKQVLEIRSF   64 (71)
Q Consensus        33 ~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~   64 (71)
                      -+|-|+.+....+-.||||.|||.|+.-|-++
T Consensus      1045 MTLKTFHFAGVASMNiTlGVPRIkEIINAsk~ 1076 (1386)
T KOG0261|consen 1045 MTLKTFHFAGVASMNITLGVPRIKEIINASKT 1076 (1386)
T ss_pred             eeeeeeeecceeeeeeccCcchHHHHHhhhcc
Confidence            36889999999999999999999999998765


No 84 
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein. The gene name is accB or fabE.
Probab=72.88  E-value=11  Score=25.74  Aligned_cols=18  Identities=17%  Similarity=0.274  Sum_probs=16.5

Q ss_pred             EEEecCcEEecCCeEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l   38 (71)
                      +++++|+.|..|+.|+.+
T Consensus       138 i~v~~g~~V~~Gq~L~~i  155 (156)
T TIGR00531       138 ILVENGQPVEYGQPLIVI  155 (156)
T ss_pred             EEeCCCCEECCCCEEEEE
Confidence            589999999999999975


No 85 
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=72.28  E-value=4.3  Score=27.38  Aligned_cols=35  Identities=23%  Similarity=0.271  Sum_probs=23.7

Q ss_pred             CCCCCcEEEEEeCCCcEE-----------------------------EEecCcEEecCCeEEEE
Q 042693            4 HLKSDQILIVQATPGAIS-----------------------------FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus         4 ~~~sGqii~i~~~~ga~l-----------------------------~v~~G~~V~~G~~L~~l   38 (71)
                      ++.+|.|+.+++..|..+                             +++.||.|..|++|+++
T Consensus        66 Ap~~G~V~~i~V~~Gd~V~~Gq~L~~lEamKme~eI~Ap~~G~V~~i~v~~Gd~V~~G~~L~~I  129 (130)
T PRK06549         66 SPMPGTILKVLVAVGDQVTENQPLLILEAMKMENEIVASSAGTVTAIHVTPGQVVNPGDGLITI  129 (130)
T ss_pred             CCCCEEEEEEEeCCCCEECCCCEEEEEeccCccEEEEcCCCeEEEEEEeCCCCEeCCCCEEEEe
Confidence            566788888885555443                             35667777777777765


No 86 
>PF13437 HlyD_3:  HlyD family secretion protein
Probab=71.91  E-value=6.3  Score=23.77  Aligned_cols=29  Identities=10%  Similarity=0.138  Sum_probs=20.6

Q ss_pred             CCCCCcEEEEEeCCCcEEEEecCcEEecCCeEEEEEe
Q 042693            4 HLKSDQILIVQATPGAISFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus         4 ~~~sGqii~i~~~~ga~l~v~~G~~V~~G~~L~~l~~   40 (71)
                      +|.+|.|..+        .++.|++|.+|++|+++.-
T Consensus         4 AP~~G~V~~~--------~~~~G~~v~~g~~l~~i~~   32 (105)
T PF13437_consen    4 APFDGVVVSI--------NVQPGEVVSAGQPLAEIVD   32 (105)
T ss_pred             CCCCEEEEEE--------eCCCCCEECCCCEEEEEEc
Confidence            4556665433        3566899999999998764


No 87 
>PRK06748 hypothetical protein; Validated
Probab=70.11  E-value=6.8  Score=24.63  Aligned_cols=31  Identities=13%  Similarity=-0.036  Sum_probs=22.6

Q ss_pred             eCCCcE---EEEecCcEEecCCeEEEEEeehhcc
Q 042693           15 ATPGAI---SFRHYGAFLHKGNKLVTFIYEKLRS   45 (71)
Q Consensus        15 ~~~ga~---l~v~~G~~V~~G~~L~~l~~e~~kt   45 (71)
                      +|..++   ++++.||.|..|++|+.+--..+-+
T Consensus        47 Ap~~G~v~~i~v~~Gd~V~vG~~la~I~~~~~~~   80 (83)
T PRK06748         47 VGISGYIESLEVVEGQAIADQKLLITVRDDLLIT   80 (83)
T ss_pred             cCCCEEEEEEEeCCCCEECCCCEEEEEECCeeec
Confidence            444444   4689999999999999985444433


No 88 
>TIGR02386 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit, predominant form. Bacteria have a single DNA-directed RNA polymerase, with required subunits that include alpha, beta, and beta-prime. This model describes the predominant architecture of the beta-prime subunit in most bacteria. This model excludes from among the bacterial mostly sequences from the cyanobacteria, where RpoC is replaced by two tandem genes homologous to it but also encoding an additional domain.
Probab=69.96  E-value=7.7  Score=34.56  Aligned_cols=34  Identities=24%  Similarity=0.210  Sum_probs=27.6

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhh
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEI   61 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEA   61 (71)
                      +|.++++.|++||.|++|+.|.             .|-+-..++|+.
T Consensus       962 ip~~~~l~v~~gd~V~~G~~l~-------------~g~~~~~~il~v  995 (1140)
T TIGR02386       962 IPFGAQLRVKDGDSVSAGDKLT-------------EGSIDPHDLLRI  995 (1140)
T ss_pred             ccCCceEEecCCCEEccCCccc-------------CCCCCHHHHHHh
Confidence            9999999999999999999886             455555566553


No 89 
>TIGR02388 rpoC2_cyan DNA-directed RNA polymerase, beta'' subunit. The family consists of the product of the rpoC2 gene, a subunit of DNA-directed RNA polymerase of cyanobacteria and chloroplasts. RpoC2 corresponds largely to the C-terminal region of the RpoC (the beta' subunit) of other bacteria. Members of this family are designated beta'' in chloroplasts/plastids, and beta' (confusingly) in Cyanobacteria, where RpoC1 is called beta' in chloroplasts/plastids and gamma in Cyanobacteria. We prefer to name this family beta'', after its organellar members, to emphasize that this RpoC1 and RpoC2 together replace RpoC in other bacteria.
Probab=69.00  E-value=11  Score=34.06  Aligned_cols=30  Identities=20%  Similarity=0.336  Sum_probs=26.8

Q ss_pred             EEEeCCCcEEEEecCcEEecCCeEEEEEee
Q 042693           12 IVQATPGAISFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        12 ~i~~~~ga~l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      .+.+|+++.|+|++|+.|+++.+||.+...
T Consensus       396 ~~~ip~~s~l~v~~~q~v~~~q~iae~~~~  425 (1227)
T TIGR02388       396 EIEVTQGSLLFVEDGQTVDAGQLLAEIALG  425 (1227)
T ss_pred             EEEECCCCEEEEECCCEEecCcEEEEeccC
Confidence            344999999999999999999999998864


No 90 
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional
Probab=68.52  E-value=4.7  Score=30.92  Aligned_cols=17  Identities=24%  Similarity=0.380  Sum_probs=16.2

Q ss_pred             EecCcEEecCCeEEEEE
Q 042693           23 RHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        23 v~~G~~V~~G~~L~~l~   39 (71)
                      +..||.|++|++|++|-
T Consensus       140 ~~~Gd~VkkGq~La~l~  156 (409)
T PRK09783        140 LTVGDKVQKGTPLLDLT  156 (409)
T ss_pred             cCCCCEECCCCEEEEEe
Confidence            78999999999999997


No 91 
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid dehydrogenase (BCDH), contain at least three different enzymes, 2-oxo acid dehydrogenase (E1), dihydrolipoyl acyltransferase (E2) and dihydrolipoamide dehydrogenase (E3) and play a key role in redox regulation. E2, the central component of the complex, catalyzes the transfer of the acyl group of CoA from E1 to E3 via reductive acetylation of a lipoyl group covalently attached to a lysine residue.
Probab=67.90  E-value=9.1  Score=20.08  Aligned_cols=22  Identities=14%  Similarity=0.125  Sum_probs=17.9

Q ss_pred             EEEEecCcEEecCCeEEEEEee
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      ..+++.|+.+..|++++.+.-.
T Consensus        19 ~~~~~~g~~v~~~~~l~~~~~~   40 (74)
T cd06849          19 EWLVKEGDSVEEGDVLAEVETD   40 (74)
T ss_pred             EEEECCCCEEcCCCEEEEEEeC
Confidence            3578899999999999988444


No 92 
>PF01551 Peptidase_M23:  Peptidase family M23;  InterPro: IPR016047 Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins such as Swiss:P33648 for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.; PDB: 3IT5_A 3IT7_B 2GU1_A 3NYY_A 2HSI_B 3SLU_B 3UZ0_D 3TUF_B 1QWY_A 2B44_B ....
Probab=67.20  E-value=4.7  Score=24.23  Aligned_cols=18  Identities=17%  Similarity=0.084  Sum_probs=14.4

Q ss_pred             EecCcEEecCCeEEEEEe
Q 042693           23 RHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        23 v~~G~~V~~G~~L~~l~~   40 (71)
                      ++.||.|++|+.|+++--
T Consensus        57 v~~G~~V~~G~~IG~~g~   74 (96)
T PF01551_consen   57 VKVGDRVKAGQVIGTVGN   74 (96)
T ss_dssp             S-TTSEE-TTCEEEEEBS
T ss_pred             ceecccccCCCEEEecCC
Confidence            788999999999999873


No 93 
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=66.79  E-value=16  Score=24.88  Aligned_cols=18  Identities=17%  Similarity=0.196  Sum_probs=16.4

Q ss_pred             EEEecCcEEecCCeEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l   38 (71)
                      +++++|+.|..|+.|+.+
T Consensus       137 i~v~~g~~V~~Gq~L~~i  154 (155)
T PRK06302        137 ILVENGQPVEFGQPLFVI  154 (155)
T ss_pred             EEcCCCCEeCCCCEEEEe
Confidence            579999999999999976


No 94 
>PRK00566 DNA-directed RNA polymerase subunit beta'; Provisional
Probab=64.69  E-value=12  Score=33.54  Aligned_cols=35  Identities=17%  Similarity=0.268  Sum_probs=27.7

Q ss_pred             eCCCcEEEEecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhc
Q 042693           15 ATPGAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIR   62 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR   62 (71)
                      +|.++.+.|++||.|++|+.|.             .|-+-..+++|..
T Consensus       964 vp~~~~~~v~~gd~v~~G~~l~-------------~g~~~~~~il~v~  998 (1156)
T PRK00566        964 IPKGKHLLVQEGDHVEAGDKLT-------------DGSIDPHDILRVL  998 (1156)
T ss_pred             ccCCCeeeecCCCEEccCCccc-------------CCCCCHHHHHHhc
Confidence            9999999999999999999873             3555566666543


No 95 
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS). These domains transport CO2, acyl, or methylamine, respectively, between components of the complex/protein via a biotinyl or lipoyl group, which is covalently attached to a highly conserved lysine residue.
Probab=63.73  E-value=10  Score=21.57  Aligned_cols=22  Identities=23%  Similarity=0.273  Sum_probs=18.1

Q ss_pred             EEEecCcEEecCCeEEEEEeeh
Q 042693           21 SFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      .+++.|+.|.+|++|+++-..+
T Consensus        19 ~~v~~G~~v~~g~~l~~ie~~k   40 (73)
T cd06663          19 WLKKVGDKVKKGDVLAEIEAMK   40 (73)
T ss_pred             EEcCCcCEECCCCEEEEEEeCC
Confidence            4678999999999999985544


No 96 
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=63.57  E-value=7.9  Score=26.62  Aligned_cols=17  Identities=18%  Similarity=0.393  Sum_probs=11.2

Q ss_pred             EEecCcEEecCCeEEEE
Q 042693           22 FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l   38 (71)
                      +++.|+.|..|+.|+++
T Consensus       136 ~v~~Gd~V~~Gq~L~~I  152 (153)
T PRK05641        136 LVKEGDTVDTGQPLIEL  152 (153)
T ss_pred             EcCCCCEECCCCEEEEe
Confidence            35667777777777665


No 97 
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional
Probab=61.24  E-value=10  Score=26.84  Aligned_cols=17  Identities=24%  Similarity=0.436  Sum_probs=9.3

Q ss_pred             EEecCcEEecCCeEEEE
Q 042693           22 FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l   38 (71)
                      +++.||.|++||+|+.+
T Consensus        23 ~~~~g~~v~~~~~~~~~   39 (371)
T PRK14875         23 LVQEGDEVEKGDELLDV   39 (371)
T ss_pred             EcCCCCEeCCCCEEEEE
Confidence            44555555555555544


No 98 
>TIGR00999 8a0102 Membrane Fusion Protein cluster 2 (function with RND porters).
Probab=59.92  E-value=6.1  Score=27.28  Aligned_cols=15  Identities=27%  Similarity=0.273  Sum_probs=13.8

Q ss_pred             CcEEecCCeEEEEEe
Q 042693           26 GAFLHKGNKLVTFIY   40 (71)
Q Consensus        26 G~~V~~G~~L~~l~~   40 (71)
                      |+.|++|++|+++--
T Consensus         1 G~~VkkG~~L~~ld~   15 (265)
T TIGR00999         1 GDPVKKGQVLAVVDS   15 (265)
T ss_pred             CCcccCCCEEEEEcc
Confidence            899999999999985


No 99 
>PF13142 DUF3960:  Domain of unknown function (DUF3960)
Probab=59.18  E-value=5.1  Score=25.93  Aligned_cols=33  Identities=15%  Similarity=0.236  Sum_probs=30.3

Q ss_pred             CcEEEEecCcEEecCCeEEEEEeehhccCCccC
Q 042693           18 GAISFRHYGAFLHKGNKLVTFIYEKLRSCDLTR   50 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l~~e~~kt~DItq   50 (71)
                      .+++..++.+++++-..++++.|..-+.-+|+|
T Consensus        40 rTIl~w~~KefyKeenli~~i~Ygm~~~~~lp~   72 (87)
T PF13142_consen   40 RTILMWKEKEFYKEENLIPFILYGMKKGYQLPQ   72 (87)
T ss_pred             eEEeeechhhHHhhhccceeEEeeccccccCcc
Confidence            678999999999999999999999998888775


No 100
>PLN02226 2-oxoglutarate dehydrogenase E2 component
Probab=58.97  E-value=19  Score=29.01  Aligned_cols=18  Identities=17%  Similarity=0.268  Sum_probs=14.4

Q ss_pred             EEecCcEEecCCeEEEEE
Q 042693           22 FRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~   39 (71)
                      +++.||.|..|++|+.+-
T Consensus       149 lv~eGd~V~vG~~L~~I~  166 (463)
T PLN02226        149 LVKEGDTVEPGTKVAIIS  166 (463)
T ss_pred             EeCCCCEecCCCEEEEec
Confidence            678888888888888774


No 101
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism]
Probab=57.17  E-value=11  Score=28.84  Aligned_cols=20  Identities=15%  Similarity=0.117  Sum_probs=17.7

Q ss_pred             EEEEecCcEEecCCeEEEEE
Q 042693           20 ISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ..++++|+.|++|++|+++.
T Consensus        67 ~~~~~DG~~v~~g~~i~~~~   86 (280)
T COG0157          67 QWLVKDGDRVKPGDVLAEIE   86 (280)
T ss_pred             EEEcCCCCEeCCCCEEEEEe
Confidence            34899999999999999875


No 102
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD.
Probab=57.14  E-value=18  Score=26.65  Aligned_cols=27  Identities=22%  Similarity=0.219  Sum_probs=23.4

Q ss_pred             EEeCCCcEEE--EecCcEEecCCeEEEEE
Q 042693           13 VQATPGAISF--RHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        13 i~~~~ga~l~--v~~G~~V~~G~~L~~l~   39 (71)
                      +++|.+..++  ++-|+.|++|+.|+++.
T Consensus       234 v~Ap~~Gi~~~~~~~G~~V~~Gq~lg~I~  262 (293)
T cd06255         234 VAAIHGGLFEPSVPAGDTIPAGQPLGRVV  262 (293)
T ss_pred             EecCCCeEEEEecCCCCEecCCCEEEEEE
Confidence            3488888885  89999999999999985


No 103
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase
Probab=57.09  E-value=13  Score=28.45  Aligned_cols=27  Identities=30%  Similarity=0.418  Sum_probs=21.7

Q ss_pred             CCcEEEEecCcEEecCCeEEEEEeehh
Q 042693           17 PGAISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        17 ~ga~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      .|..++++.||.|++|++|+.+--.+.
T Consensus       214 pge~w~VkvGDsVkkGQvLavIEAMKm  240 (274)
T PLN02983        214 PGEPPFVKVGDKVQKGQVVCIIEAMKL  240 (274)
T ss_pred             CCCcceeCCCCEecCCCEEEEEEeece
Confidence            456778999999999999998765544


No 104
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A).
Probab=56.96  E-value=18  Score=26.01  Aligned_cols=18  Identities=22%  Similarity=0.532  Sum_probs=14.7

Q ss_pred             EEecCcEEecCCeEEEEE
Q 042693           22 FRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~   39 (71)
                      +++.|++|.+|++|+++.
T Consensus       219 ~~~~G~~v~~g~~l~~i~  236 (334)
T TIGR00998       219 FVQVGQVVSPGQPLMAVV  236 (334)
T ss_pred             ecCCCCEeCCCCeeEEEE
Confidence            467788889999998875


No 105
>PF13375 RnfC_N:  RnfC Barrel sandwich hybrid domain
Probab=54.71  E-value=15  Score=23.53  Aligned_cols=21  Identities=19%  Similarity=0.167  Sum_probs=18.2

Q ss_pred             CcEEEEecCcEEecCCeEEEE
Q 042693           18 GAISFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l   38 (71)
                      -+...|+.||.|.+|+.|++-
T Consensus        41 ~~~p~V~~Gd~V~~GQ~Ia~~   61 (101)
T PF13375_consen   41 PAEPVVKVGDKVKKGQLIAEA   61 (101)
T ss_pred             cceEEEcCCCEEcCCCEEEec
Confidence            367789999999999999975


No 106
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases. This subgroup includes Pseudomonas aeruginosa AotO and related proteins. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD. The gene encoding 
Probab=53.74  E-value=21  Score=27.29  Aligned_cols=27  Identities=19%  Similarity=0.417  Sum_probs=23.3

Q ss_pred             EEeCCCcEEE--EecCcEEecCCeEEEEE
Q 042693           13 VQATPGAISF--RHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        13 i~~~~ga~l~--v~~G~~V~~G~~L~~l~   39 (71)
                      +++|.|..+.  ++-|+.|++|+.|+++.
T Consensus       292 v~Ap~~Gl~~~~~~~Gd~V~~G~~lg~I~  320 (359)
T cd06250         292 LYAPAGGMVVYRAAPGDWVEAGDVLAEIL  320 (359)
T ss_pred             EeCCCCeEEEEecCCCCEecCCCEEEEEE
Confidence            4488888885  78899999999999985


No 107
>PF05896 NQRA:  Na(+)-translocating NADH-quinone reductase subunit A (NQRA);  InterPro: IPR008703 This family consists of several bacterial Na+-translocating NADH-quinone reductase subunit A (NQRA) proteins. The Na+-translocating NADH: ubiquinone oxidoreductase (Na+-NQR) generates an electrochemical Na+ potential driven by aerobic respiration [].; GO: 0016655 oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor, 0006814 sodium ion transport, 0055114 oxidation-reduction process
Probab=53.12  E-value=13  Score=27.93  Aligned_cols=20  Identities=15%  Similarity=0.159  Sum_probs=17.4

Q ss_pred             CcEEEEecCcEEecCCeEEE
Q 042693           18 GAISFRHYGAFLHKGNKLVT   37 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~   37 (71)
                      .-.+.|+.||.|++|++|+.
T Consensus        40 ~Pkm~VkeGD~Vk~Gq~LF~   59 (257)
T PF05896_consen   40 KPKMLVKEGDRVKAGQPLFE   59 (257)
T ss_pred             CccEEeccCCEEeCCCeeEe
Confidence            34689999999999999985


No 108
>PRK09282 pyruvate carboxylase subunit B; Validated
Probab=52.35  E-value=22  Score=29.20  Aligned_cols=22  Identities=14%  Similarity=0.114  Sum_probs=16.8

Q ss_pred             EEEecCcEEecCCeEEEEEeeh
Q 042693           21 SFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      +.++.|+.|++|++|+++--.+
T Consensus       536 ~~V~~Gd~V~~Gq~L~~ieamK  557 (592)
T PRK09282        536 VKVKEGDKVKAGDTVLVLEAMK  557 (592)
T ss_pred             EEeCCCCEECCCCEEEEEeccc
Confidence            3688888899999888875443


No 109
>PRK10871 nlpD lipoprotein NlpD; Provisional
Probab=52.19  E-value=19  Score=27.77  Aligned_cols=20  Identities=15%  Similarity=0.099  Sum_probs=16.9

Q ss_pred             EEEEecCcEEecCCeEEEEE
Q 042693           20 ISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~   39 (71)
                      .+.|+.||.|++|+.|+++-
T Consensus       271 ~i~Vk~Gq~V~~Gq~Ig~~G  290 (319)
T PRK10871        271 TMLVREQQEVKAGQKIATMG  290 (319)
T ss_pred             ccccCCcCEECCCCeEEeEc
Confidence            35688899999999999764


No 110
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion]
Probab=52.17  E-value=14  Score=28.74  Aligned_cols=27  Identities=26%  Similarity=0.434  Sum_probs=21.7

Q ss_pred             CCcEE--EEecCcEEecCCeEEEEEeehh
Q 042693           17 PGAIS--FRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        17 ~ga~l--~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      .|.+.  |++.||.|++||+|+.+--.|.
T Consensus        16 EG~I~~W~~k~GD~V~~gd~L~eVeTDKa   44 (404)
T COG0508          16 EGTIVEWLKKVGDKVKEGDVLVEVETDKA   44 (404)
T ss_pred             eEEEEEEecCCCCeecCCCeeEEEEcCce
Confidence            34444  8999999999999998877765


No 111
>PRK10476 multidrug resistance protein MdtN; Provisional
Probab=51.68  E-value=17  Score=26.75  Aligned_cols=18  Identities=22%  Similarity=0.231  Sum_probs=14.1

Q ss_pred             EEecCcEEecCCeEEEEE
Q 042693           22 FRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~   39 (71)
                      +++.|+.|.+|++|+++.
T Consensus       223 ~~~~G~~V~~g~~l~~I~  240 (346)
T PRK10476        223 KVSVGEFAAPMQPIFTLI  240 (346)
T ss_pred             ecCCCCCcCCCCeEEEEe
Confidence            467788888888888875


No 112
>MTH00025 ATP8 ATP synthase F0 subunit 8; Validated
Probab=51.59  E-value=6.4  Score=24.30  Aligned_cols=14  Identities=29%  Similarity=0.304  Sum_probs=12.5

Q ss_pred             chhhHhhhhhhcCC
Q 042693           51 ALSKVKQVLEIRSF   64 (71)
Q Consensus        51 GLPkVeeLfEAR~~   64 (71)
                      -|||+++++..|..
T Consensus        31 iLP~i~~~~~~R~~   44 (70)
T MTH00025         31 VLPTIKRNWLIRKS   44 (70)
T ss_pred             HHHHHHHHHHHHHH
Confidence            38999999999986


No 113
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD.
Probab=51.47  E-value=34  Score=25.31  Aligned_cols=29  Identities=21%  Similarity=0.425  Sum_probs=24.3

Q ss_pred             EEEeCCCcEEE--EecCcEEecCCeEEEEEe
Q 042693           12 IVQATPGAISF--RHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        12 ~i~~~~ga~l~--v~~G~~V~~G~~L~~l~~   40 (71)
                      .++.|.+..+.  ++-|+.|++|+.|+.+.-
T Consensus       231 ~v~A~~~Gl~~~~~~~G~~V~~Gq~lg~i~d  261 (298)
T cd06253         231 YVNAETSGIFVPAKHLGDIVKRGDVIGEIVD  261 (298)
T ss_pred             EEEcCCCeEEEECcCCCCEECCCCEEEEEeC
Confidence            34488888885  899999999999999864


No 114
>TIGR02994 ectoine_eutE ectoine utilization protein EutE. Members of this family, part of the succinylglutamate desuccinylase / aspartoacylase family (pfam04952), belong to ectoine utilization operons, as found in Sinorhizobium meliloti 1021 (where it the operon is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida.
Probab=51.01  E-value=25  Score=26.62  Aligned_cols=28  Identities=14%  Similarity=0.135  Sum_probs=23.9

Q ss_pred             EEeCCCcEEE--EecCcEEecCCeEEEEEe
Q 042693           13 VQATPGAISF--RHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        13 i~~~~ga~l~--v~~G~~V~~G~~L~~l~~   40 (71)
                      +++|.+..+.  ++-|+.|++|+.|+++.-
T Consensus       258 v~Ap~~Gi~~~~v~~G~~V~~G~~lg~I~d  287 (325)
T TIGR02994       258 IFAEDDGLIEFMIDLGDPVSKGDVIARVYP  287 (325)
T ss_pred             EEcCCCeEEEEecCCCCEeCCCCEEEEEEC
Confidence            4588888875  888999999999999875


No 115
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]
Probab=50.78  E-value=17  Score=29.27  Aligned_cols=34  Identities=12%  Similarity=0.175  Sum_probs=25.3

Q ss_pred             CcEEEEE--------eCCCcEEEEecCcEEecCCeEEEEEee
Q 042693            8 DQILIVQ--------ATPGAISFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus         8 Gqii~i~--------~~~ga~l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      |+|+.+.        .--...|.|+.|++|..|++++.+-..
T Consensus       352 G~vvIldhG~gy~slyg~~~~i~v~~G~~V~AGepIa~~G~s  393 (420)
T COG4942         352 GLVVILDHGGGYHSLYGGNQSILVNPGQFVKAGEPIALVGSS  393 (420)
T ss_pred             ceEEEEEcCCccEEEecccceeeecCCCEeecCCchhhccCC
Confidence            5555555        334567889999999999999987543


No 116
>cd04252 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate kinase (NAGK) of the fungal arginine-biosynthetic pathway (fArgBP). The nuclear-encoded, mitochondrial polyprotein precursor with an N-terminal NAGK (ArgB) domain (this CD), a central DUF619 domain, and a C-terminal reductase domain (ArgC, N-Acetylglutamate Phosphate Reductase, NAGPR). The precursor is cleaved in the mitochondria into two distinct enzymes (NAGK-DUF619 and NAGPR). Native molecular weights of these proteins indicate that the kinase is an octamer whereas the reductase is a dimer. This CD also includes some gamma-proteobacteria (Xanthomonas and Xylella) NAG kinases with an N-terminal NAGK (ArgB) domain (this CD) and a C-terminal DUF619 domain. The DUF619 domain is described as a putative distant homolog of the acetyltransferase, ArgA, predicted to function in NAG synthase association in fungi. Eukaryotic sequences have an N-terminal mitochondrial transit peptide. Members of this NAG kinase domain CD belong to th
Probab=50.37  E-value=35  Score=24.41  Aligned_cols=33  Identities=15%  Similarity=0.238  Sum_probs=23.0

Q ss_pred             cCCeEEEEEe-----ehhccCCccCch-hhHhhhhhhcC
Q 042693           31 KGNKLVTFIY-----EKLRSCDLTRAL-SKVKQVLEIRS   63 (71)
Q Consensus        31 ~G~~L~~l~~-----e~~kt~DItqGL-PkVeeLfEAR~   63 (71)
                      .|..+-.+..     +..+++||++|. ||++..+++..
T Consensus       180 ~g~~i~~i~~~~~~~~l~~~~~vtgGM~~Kl~~~~~~~~  218 (248)
T cd04252         180 TGKKISAINLDEEYDDLMKQPWVKYGTKLKIKEIKELLD  218 (248)
T ss_pred             CCCcccccCHHHHHHHHHHcCCcCCchHHHHHHHHHHHH
Confidence            4666666642     234568999776 99998888753


No 117
>PF10011 DUF2254:  Predicted membrane protein (DUF2254);  InterPro: IPR018723  Members of this family of proteins comprises various hypothetical and putative membrane proteins. Their exact function, has not, as yet, been defined. 
Probab=50.14  E-value=30  Score=26.40  Aligned_cols=36  Identities=14%  Similarity=0.185  Sum_probs=27.5

Q ss_pred             CCCCCcEEEEE--------eCCCcEE--EEecCcEEecCCeEEEEE
Q 042693            4 HLKSDQILIVQ--------ATPGAIS--FRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus         4 ~~~sGqii~i~--------~~~ga~l--~v~~G~~V~~G~~L~~l~   39 (71)
                      ...||.|-.|+        -.-++.+  .+.-|++|.+|++|++..
T Consensus       200 a~~~GYvq~Id~~~L~~~a~~~~~~i~l~~~~G~fV~~g~pl~~v~  245 (371)
T PF10011_consen  200 APRSGYVQAIDYDRLVELAEEHDVVIRLEVRPGDFVVEGTPLARVW  245 (371)
T ss_pred             cCCCcEEEEecHHHHHHHHHHCCcEEEEEeCCCCeECCCCeEEEEe
Confidence            45788888887        2234444  578999999999999995


No 118
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional
Probab=49.61  E-value=45  Score=23.57  Aligned_cols=25  Identities=20%  Similarity=0.197  Sum_probs=19.9

Q ss_pred             eCCCcE---EEEecCcEEecCCeEEEEE
Q 042693           15 ATPGAI---SFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        15 ~~~ga~---l~v~~G~~V~~G~~L~~l~   39 (71)
                      +|..++   +.++.|+.|..|++|+.+.
T Consensus        50 a~~~g~~~~~~~~~g~~v~~g~~l~~i~   77 (371)
T PRK14875         50 APAAGTLRRQVAQEGETLPVGALLAVVA   77 (371)
T ss_pred             cCCCeEEEEEEcCCCCEeCCCCEEEEEe
Confidence            555443   4689999999999999995


No 119
>COG3608 Predicted deacylase [General function prediction only]
Probab=49.12  E-value=22  Score=27.64  Aligned_cols=28  Identities=21%  Similarity=0.373  Sum_probs=23.5

Q ss_pred             EEeCCCcEE--EEecCcEEecCCeEEEEEe
Q 042693           13 VQATPGAIS--FRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        13 i~~~~ga~l--~v~~G~~V~~G~~L~~l~~   40 (71)
                      +++|.+..+  +++=||.|++||+|+++.-
T Consensus       259 i~Ap~~G~v~~~v~lGd~VeaG~~la~i~~  288 (331)
T COG3608         259 IRAPAGGLVEFLVDLGDKVEAGDVLATIHD  288 (331)
T ss_pred             eecCCCceEEEeecCCCcccCCCeEEEEec
Confidence            447877766  6899999999999999875


No 120
>PRK11637 AmiB activator; Provisional
Probab=48.45  E-value=19  Score=27.56  Aligned_cols=21  Identities=14%  Similarity=0.135  Sum_probs=16.8

Q ss_pred             EEEEecCcEEecCCeEEEEEe
Q 042693           20 ISFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~   40 (71)
                      .+.|..|+.|.+|++|+++-.
T Consensus       380 ~~~v~~G~~V~~G~~ig~~g~  400 (428)
T PRK11637        380 SALVSVGAQVRAGQPIALVGS  400 (428)
T ss_pred             cCCCCCcCEECCCCeEEeecC
Confidence            345888999999999997743


No 121
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD.
Probab=48.42  E-value=30  Score=25.69  Aligned_cols=27  Identities=15%  Similarity=-0.011  Sum_probs=22.8

Q ss_pred             EEeCCCcEEE--EecCcEEecCCeEEEEE
Q 042693           13 VQATPGAISF--RHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        13 i~~~~ga~l~--v~~G~~V~~G~~L~~l~   39 (71)
                      +++|.+..+.  ++-|+.|++|+.|+++.
T Consensus       247 v~A~~~G~~~~~~~~G~~V~~G~~lg~i~  275 (316)
T cd06252         247 VFAPHPGLFEPLVDLGDEVSAGQVAGRIH  275 (316)
T ss_pred             EEcCCCeEEEEecCCCCEEcCCCEEEEEE
Confidence            4488888885  88899999999999975


No 122
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD.
Probab=48.35  E-value=27  Score=25.48  Aligned_cols=27  Identities=30%  Similarity=0.386  Sum_probs=22.4

Q ss_pred             EEeCCCcEEE--EecCcEEecCCeEEEEE
Q 042693           13 VQATPGAISF--RHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        13 i~~~~ga~l~--v~~G~~V~~G~~L~~l~   39 (71)
                      ++.|.+..+.  ++-||.|++|+.|+++.
T Consensus       222 v~A~~~G~~~~~~~~Gd~V~~G~~ig~i~  250 (287)
T cd06251         222 VRAPQGGLLRSLVKLGDKVKKGQLLATIT  250 (287)
T ss_pred             EecCCCeEEEEecCCCCEECCCCEEEEEE
Confidence            4477777774  88999999999999985


No 123
>TIGR00164 PS_decarb_rel phosphatidylserine decarboxylase precursor-related protein. It is unclear whether this protein is a form of phosphatidylserine decarboxylase or is a related enzyme. It is found in Neisseria gonorrhoeae, Mycobacterium tuberculosis, and several archaeal species, all of which lack known phosphatidylserine decarboxylase.
Probab=46.95  E-value=29  Score=24.14  Aligned_cols=22  Identities=14%  Similarity=0.167  Sum_probs=18.9

Q ss_pred             eCCCcEEEEecCcEEecCCeEE
Q 042693           15 ATPGAISFRHYGAFLHKGNKLV   36 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~   36 (71)
                      +|++..+.++.|+.|+.|++|+
T Consensus       161 ~p~~~~~~v~~G~~V~~G~tli  182 (189)
T TIGR00164       161 LPENAQAQVKVGEKVTAGETVL  182 (189)
T ss_pred             EcCCCccccCCCCEEEeceEEE
Confidence            8888888999999999998654


No 124
>PRK05305 phosphatidylserine decarboxylase; Provisional
Probab=46.70  E-value=29  Score=24.39  Aligned_cols=22  Identities=14%  Similarity=0.160  Sum_probs=18.4

Q ss_pred             EeCCCcEEEEecCcEEecCCeE
Q 042693           14 QATPGAISFRHYGAFLHKGNKL   35 (71)
Q Consensus        14 ~~~~ga~l~v~~G~~V~~G~~L   35 (71)
                      .+|++..+.++-||.|+.|+++
T Consensus       180 ~~p~~~~~~V~~G~kV~~Getv  201 (206)
T PRK05305        180 YLPLGTEPLVSVGQKVVAGETV  201 (206)
T ss_pred             EEcCCCcccccCCCEEEcccEE
Confidence            3888888899999999999754


No 125
>PRK01202 glycine cleavage system protein H; Provisional
Probab=46.51  E-value=35  Score=22.46  Aligned_cols=32  Identities=22%  Similarity=0.256  Sum_probs=24.1

Q ss_pred             CCcEEEEe---cCcEEecCCeEEEEEeehhccCCcc
Q 042693           17 PGAISFRH---YGAFLHKGNKLVTFIYEKLRSCDLT   49 (71)
Q Consensus        17 ~ga~l~v~---~G~~V~~G~~L~~l~~e~~kt~DIt   49 (71)
                      .|.+.+++   -|+.|++|++++++-..+. ..||.
T Consensus        36 lG~i~~v~lp~~G~~v~~g~~~~~IEs~K~-~~~i~   70 (127)
T PRK01202         36 LGDIVFVELPEVGDEVKAGETFGVVESVKA-ASDIY   70 (127)
T ss_pred             cCCeeEEEcCCCCCEecCCCEEEEEEEcce-eeeee
Confidence            37777777   8999999999999966554 33443


No 126
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional
Probab=45.92  E-value=23  Score=28.10  Aligned_cols=21  Identities=5%  Similarity=0.180  Sum_probs=16.6

Q ss_pred             EEEecCcEEecCCeEEEEEee
Q 042693           21 SFRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e   41 (71)
                      .+++.||.|++||+|+.+--.
T Consensus        64 w~v~~Gd~V~~Gd~L~~vEtd   84 (418)
T PTZ00144         64 WKKKVGDYVKEDEVICIIETD   84 (418)
T ss_pred             EEeCCCCEeCCCCEEEEEEEc
Confidence            378889999999999877543


No 127
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase
Probab=44.98  E-value=52  Score=25.20  Aligned_cols=24  Identities=13%  Similarity=0.101  Sum_probs=18.9

Q ss_pred             eCCCcE---EEEecCcEEecCCeEEEE
Q 042693           15 ATPGAI---SFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        15 ~~~ga~---l~v~~G~~V~~G~~L~~l   38 (71)
                      .|..++   +++++|+.|..|++|+.+
T Consensus       246 AP~sGtV~eIlVkeGD~V~vGqpL~~I  272 (274)
T PLN02983        246 ADQSGTIVEILAEDGKPVSVDTPLFVI  272 (274)
T ss_pred             cCCCeEEEEEecCCCCEeCCCCEEEEe
Confidence            454444   478999999999999987


No 128
>MTH00169 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=44.43  E-value=11  Score=22.82  Aligned_cols=16  Identities=38%  Similarity=0.490  Sum_probs=13.8

Q ss_pred             chhhHhhhhhhcCCcc
Q 042693           51 ALSKVKQVLEIRSFDL   66 (71)
Q Consensus        51 GLPkVeeLfEAR~~~~   66 (71)
                      .|||+.++++.|...+
T Consensus        31 iLPri~~~l~~R~~~~   46 (67)
T MTH00169         31 ILPKIQQQLVIRTKGV   46 (67)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            5999999999998743


No 129
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family. Members of this protein family are probable accessory proteins for the biosynthesis of enzymes with labile selenium-containing centers, different from selenocysteine-containing proteins.
Probab=44.33  E-value=33  Score=25.85  Aligned_cols=29  Identities=21%  Similarity=0.245  Sum_probs=23.1

Q ss_pred             EEeCCCcEEE--EecCcEEecCCeEEEEEee
Q 042693           13 VQATPGAISF--RHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        13 i~~~~ga~l~--v~~G~~V~~G~~L~~l~~e   41 (71)
                      +++|...+++  ++-||.|++|++|+++.-.
T Consensus       167 IrAp~~Gi~~~~~~IGd~V~KGqvLa~I~~~  197 (256)
T TIGR03309       167 LRAPADGIVTPTKAIGDSVKKGDVIATVGDV  197 (256)
T ss_pred             EECCCCeEEeeccCCCCEEeCCCEEEEEcCE
Confidence            3377777774  7889999999999998543


No 130
>PF12390 Se-cys_synth_N:  Selenocysteine synthase N terminal
Probab=44.17  E-value=10  Score=20.30  Aligned_cols=12  Identities=25%  Similarity=0.385  Sum_probs=9.6

Q ss_pred             chhhHhhhhhhc
Q 042693           51 ALSKVKQVLEIR   62 (71)
Q Consensus        51 GLPkVeeLfEAR   62 (71)
                      .||+|++||..=
T Consensus         3 ~LPsVD~lL~~~   14 (40)
T PF12390_consen    3 QLPSVDELLQEP   14 (40)
T ss_pred             CCchHHHHHhCh
Confidence            589999998753


No 131
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases. ASTE catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid (NAA) into aspartate and acetate. NAA is abundant in the brain, and hydrolysis of NAA by ASPA may help maintain white matter. ASPA is an NAA scavenger in other tissues. Mutations in the gene encoding ASPA cause Canavan disease (CD), a fatal progressive neurodegenerative disorder involving dysmyelination and spongiform degeneration of white matter in children. This enzyme binds zinc which is necessary for activity. Measurement of elevated NAA levels in urine is used in the diagnosis of CD.
Probab=42.83  E-value=41  Score=24.49  Aligned_cols=27  Identities=19%  Similarity=0.244  Sum_probs=22.2

Q ss_pred             EEeCCCcEEE--EecCcEEecCCeEEEEE
Q 042693           13 VQATPGAISF--RHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        13 i~~~~ga~l~--v~~G~~V~~G~~L~~l~   39 (71)
                      +++|.+..+.  ++-|+.|++|++|+.+.
T Consensus       226 v~Ap~~G~~~~~~~~G~~V~~G~~lg~i~  254 (288)
T cd06254         226 VTSPASGLWYPFVKAGDTVQKGALLGYVT  254 (288)
T ss_pred             EecCCCeEEEEecCCCCEecCCCEEEEEE
Confidence            3478888875  66799999999999984


No 132
>COG5471 Uncharacterized conserved protein [Function unknown]
Probab=40.92  E-value=16  Score=24.54  Aligned_cols=15  Identities=13%  Similarity=0.275  Sum_probs=10.6

Q ss_pred             EecCcEEecCCeEEE
Q 042693           23 RHYGAFLHKGNKLVT   37 (71)
Q Consensus        23 v~~G~~V~~G~~L~~   37 (71)
                      ++.|+.|.-|+.++-
T Consensus        20 i~SGd~VlvG~~f~V   34 (107)
T COG5471          20 IKSGDLVLVGDMFAV   34 (107)
T ss_pred             cccCCEEEEeeeEEE
Confidence            567777777777664


No 133
>PRK12784 hypothetical protein; Provisional
Probab=40.83  E-value=42  Score=21.60  Aligned_cols=27  Identities=19%  Similarity=0.128  Sum_probs=22.3

Q ss_pred             EEEEecCcEEecCCeEEEEEeehhccC
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYEKLRSC   46 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e~~kt~   46 (71)
                      .+.|..||.|..+..|+++--..+-||
T Consensus        56 ~v~Ve~Gq~i~~dtlL~~~edDllitG   82 (84)
T PRK12784         56 LVNVVVGQQIHTDTLLVRLEDDLLITG   82 (84)
T ss_pred             EEEeecCceecCCcEEEEEeeceEeec
Confidence            356889999999999999987776655


No 134
>PRK15136 multidrug efflux system protein EmrA; Provisional
Probab=40.74  E-value=37  Score=25.84  Aligned_cols=18  Identities=17%  Similarity=0.222  Sum_probs=14.6

Q ss_pred             EEecCcEEecCCeEEEEE
Q 042693           22 FRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~   39 (71)
                      +++.|+.|.+|++|+++.
T Consensus       230 ~v~~G~~V~~g~pl~~Iv  247 (390)
T PRK15136        230 SVQVGAQISPTTPLMAVV  247 (390)
T ss_pred             ecCCCCEeCCCCeEEEEE
Confidence            477788888888888875


No 135
>PRK14042 pyruvate carboxylase subunit B; Provisional
Probab=40.59  E-value=58  Score=27.01  Aligned_cols=22  Identities=14%  Similarity=0.092  Sum_probs=14.8

Q ss_pred             EEEecCcEEecCCeEEEEEeeh
Q 042693           21 SFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      ++|+.||.|++|++|+.+--.|
T Consensus       539 ~~V~~Gd~V~~Gq~L~~iEamK  560 (596)
T PRK14042        539 IHVSAGDEVKAGQAVLVIEAMK  560 (596)
T ss_pred             EEeCCCCEeCCCCEEEEEEecc
Confidence            3677777777777777665443


No 136
>PF15517 TBPIP_N:  TBP-interacting protein N-terminus; PDB: 2CZR_A.
Probab=40.26  E-value=33  Score=22.68  Aligned_cols=15  Identities=20%  Similarity=0.355  Sum_probs=12.0

Q ss_pred             eCCCcEEEEecCcEE
Q 042693           15 ATPGAISFRHYGAFL   29 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V   29 (71)
                      +|...++++++|.||
T Consensus        68 vP~kgtFYi~NGaFI   82 (99)
T PF15517_consen   68 VPGKGTFYINNGAFI   82 (99)
T ss_dssp             ES-TT-EEEETTEEE
T ss_pred             ECCCCeEEEeCceEE
Confidence            899999999999986


No 137
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=39.51  E-value=31  Score=26.26  Aligned_cols=22  Identities=5%  Similarity=-0.064  Sum_probs=19.0

Q ss_pred             CcEEEEecCcEEecCCeEEEEE
Q 042693           18 GAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...+++++|+.|++|++++++.
T Consensus        83 ~v~~~~~dG~~v~~G~~i~~~~  104 (294)
T PRK06978         83 EVTWRYREGDRMTADSTVCELE  104 (294)
T ss_pred             EEEEEcCCCCEeCCCCEEEEEE
Confidence            4467899999999999999875


No 138
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=38.96  E-value=35  Score=25.49  Aligned_cols=21  Identities=10%  Similarity=-0.100  Sum_probs=18.7

Q ss_pred             cEEEEecCcEEecCCeEEEEE
Q 042693           19 AISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        19 a~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...++.+|+.|++|++++++.
T Consensus        68 ~~~~~~dG~~v~~g~~i~~i~   88 (277)
T PRK05742         68 VHWQVADGERVSANQVLFHLE   88 (277)
T ss_pred             EEEEeCCCCEEcCCCEEEEEE
Confidence            558899999999999999875


No 139
>PRK06096 molybdenum transport protein ModD; Provisional
Probab=38.85  E-value=31  Score=26.00  Aligned_cols=22  Identities=14%  Similarity=0.102  Sum_probs=18.9

Q ss_pred             CcEEEEecCcEEecCCeEEEEE
Q 042693           18 GAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...+++.+|+.|++|++|+++.
T Consensus        62 ~v~~~~~dG~~v~~G~~i~~~~   83 (284)
T PRK06096         62 TIDDAVSDGSQANAGQRLISAQ   83 (284)
T ss_pred             EEEEEeCCCCEeCCCCEEEEEE
Confidence            4566899999999999999875


No 140
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid (QA) with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to produce nicotinic acid mononucleotide (NAMN), pyrophosphate and carbon dioxide. QPRTase functions as a homodimer with two active sites, each formed by the C-terminal region of one subunit and the N-terminal region of the other.
Probab=38.49  E-value=37  Score=25.00  Aligned_cols=19  Identities=21%  Similarity=0.156  Sum_probs=17.2

Q ss_pred             EEEecCcEEecCCeEEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~   39 (71)
                      .++++|+.|++|++++++.
T Consensus        62 ~~~~dG~~v~~g~~i~~i~   80 (268)
T cd01572          62 WLVKDGDRVEPGQVLATVE   80 (268)
T ss_pred             EEeCCCCEecCCCEEEEEE
Confidence            5789999999999999875


No 141
>PRK09603 bifunctional DNA-directed RNA polymerase subunit beta/beta'; Reviewed
Probab=37.93  E-value=41  Score=33.11  Aligned_cols=22  Identities=23%  Similarity=0.459  Sum_probs=20.6

Q ss_pred             eCCCcEEEEecCcEEecCCeEE
Q 042693           15 ATPGAISFRHYGAFLHKGNKLV   36 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~   36 (71)
                      +|.+.++.|++||+|++|+.|.
T Consensus      2700 v~~~~~~~v~~gd~v~~G~~l~ 2721 (2890)
T PRK09603       2700 VDKGKQILVHADEFVHAGEAMT 2721 (2890)
T ss_pred             ccCCceeeecCCCEEccCCCcC
Confidence            9999999999999999999863


No 142
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis. G5K is subject to feedback allosteric inhibition by proline or ornithine. In microorganisms and plants, proline plays an important role as an osmoprotectant and, in mammals, ornithine biosynthesis is crucial for proper ammonia detoxification, since a G5K mutation has been shown to cause human hyperammonaemia. Microbial G5K generally consists of two domains: a catalytic G5K domain and one PUA (pseudo uridine synthases and archaeosine-specific transglycosylases) domain, and some lack the PUA domain. G5K requires free Mg for activity, it is tetrameric, and it aggregates to higher forms in a proline-dependent way. G5K lacking the PUA domain remains tetrameric, active, and proline-inhibitable, but the Mg requir
Probab=37.84  E-value=31  Score=24.54  Aligned_cols=20  Identities=20%  Similarity=0.026  Sum_probs=16.8

Q ss_pred             cCCccCch-hhHhhhhhhcCC
Q 042693           45 SCDLTRAL-SKVKQVLEIRSF   64 (71)
Q Consensus        45 t~DItqGL-PkVeeLfEAR~~   64 (71)
                      +.|+++|+ ||++..++|.+.
T Consensus       202 ~~~~tggm~~Kl~a~~~a~~~  222 (251)
T cd04242         202 SSVGTGGMRTKLKAARIATEA  222 (251)
T ss_pred             cCcccCCcHHHHHHHHHHHHC
Confidence            47999998 999999998654


No 143
>TIGR01334 modD putative molybdenum utilization protein ModD. The gene modD for a member of this family is found with molybdenum transport genes modABC in Rhodobacter capsulatus. However, disruption of modD causes only a 4-fold (rather than 500-fold for modA, modB, modC) change in the external molybdenum concentration required to suppress an alternative nitrogenase. ModD proteins are highly similar to nicotinate-nucleotide pyrophosphorylase (also called quinolinate phosphoribosyltransferase). The function unknown.
Probab=37.13  E-value=38  Score=25.39  Aligned_cols=22  Identities=14%  Similarity=-0.090  Sum_probs=18.9

Q ss_pred             CcEEEEecCcEEecCCeEEEEE
Q 042693           18 GAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...+++++|+.|++|++|+++.
T Consensus        61 ~~~~~~~dG~~v~~g~~i~~~~   82 (277)
T TIGR01334        61 SIDYAVPSGSRALAGTLLLEAK   82 (277)
T ss_pred             EEEEEeCCCCEeCCCCEEEEEE
Confidence            4456899999999999999875


No 144
>PRK14042 pyruvate carboxylase subunit B; Provisional
Probab=36.87  E-value=42  Score=27.83  Aligned_cols=18  Identities=17%  Similarity=0.253  Sum_probs=15.7

Q ss_pred             EEEecCcEEecCCeEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l   38 (71)
                      ++++.|+.|..|++|+++
T Consensus       576 i~v~~Gd~V~~G~~L~~I  593 (596)
T PRK14042        576 ILCQKGDKVTPGQVLIRV  593 (596)
T ss_pred             EEeCCcCEECCCCEEEEE
Confidence            678899999999999887


No 145
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=36.66  E-value=38  Score=25.63  Aligned_cols=20  Identities=25%  Similarity=0.273  Sum_probs=17.8

Q ss_pred             EEEEecCcEEecCCeEEEEE
Q 042693           20 ISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ..++++|+.+++|++++++.
T Consensus        79 ~~~~~dG~~v~~g~~i~~i~   98 (289)
T PRK07896         79 LDRVEDGARVPPGQALLTVT   98 (289)
T ss_pred             EEEcCCCCEecCCCEEEEEE
Confidence            46889999999999999875


No 146
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase. Synonym: quinolinate phosphoribosyltransferase (decarboxylating)
Probab=35.06  E-value=45  Score=24.55  Aligned_cols=20  Identities=10%  Similarity=0.027  Sum_probs=17.7

Q ss_pred             EEEEecCcEEecCCeEEEEE
Q 042693           20 ISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ..++++|+.+++|++++++.
T Consensus        57 ~~~~~dG~~v~~g~~i~~i~   76 (265)
T TIGR00078        57 EWLVKDGDRVEPGEVVAEVE   76 (265)
T ss_pred             EEEeCCCCEecCCCEEEEEE
Confidence            46899999999999999875


No 147
>COG0739 NlpD Membrane proteins related to metalloendopeptidases [Cell envelope biogenesis, outer membrane]
Probab=34.89  E-value=29  Score=23.92  Aligned_cols=19  Identities=11%  Similarity=0.050  Sum_probs=17.2

Q ss_pred             EEEEecCcEEecCCeEEEE
Q 042693           20 ISFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l   38 (71)
                      .+.|+.|+.|++|+.+++.
T Consensus       215 ~~~V~~G~~V~~G~~Ig~~  233 (277)
T COG0739         215 SILVKEGQKVKAGQVIGYV  233 (277)
T ss_pred             hhccCCCCEeccCCEEEEe
Confidence            6789999999999999977


No 148
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid (QA) with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to produce nicotinic acid mononucleotide (NAMN), pyrophosphate and carbon dioxide. QPRTase functions as a homodimer with two active sites, each formed by the C-terminal region of one subunit and the N-terminal region of the other.
Probab=34.41  E-value=48  Score=24.28  Aligned_cols=20  Identities=15%  Similarity=0.092  Sum_probs=17.6

Q ss_pred             EEEEecCcEEecCCeEEEEE
Q 042693           20 ISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ..++++|+.|++|++++++.
T Consensus        60 ~~~~~dG~~v~~g~~i~~i~   79 (269)
T cd01568          60 EWLVKDGDRVEAGQVLLEVE   79 (269)
T ss_pred             EEEeCCCCEecCCCEEEEEE
Confidence            35889999999999999875


No 149
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional
Probab=34.40  E-value=53  Score=25.21  Aligned_cols=28  Identities=14%  Similarity=0.092  Sum_probs=21.0

Q ss_pred             EEEeCCCcEE---EEecCcEEecCCeEEEEE
Q 042693           12 IVQATPGAIS---FRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        12 ~i~~~~ga~l---~v~~G~~V~~G~~L~~l~   39 (71)
                      .|++|-.+++   +++.|++|.+|++|+++.
T Consensus       211 ~I~AP~dGvV~~~~v~~G~~V~~g~~L~~I~  241 (409)
T PRK09783        211 TLKAPIDGVITAFDLRAGMNIAKDNVVAKIQ  241 (409)
T ss_pred             EEECCCCeEEEEEECCCCCEECCCCeEEEEE
Confidence            3556655544   578899999999999885


No 150
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=34.18  E-value=47  Score=24.77  Aligned_cols=21  Identities=19%  Similarity=0.297  Sum_probs=18.7

Q ss_pred             cEEEEecCcEEecCCeEEEEE
Q 042693           19 AISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        19 a~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...++.+|+.|++|++++.+.
T Consensus        66 v~~~~~dG~~v~~g~~i~~~~   86 (277)
T PRK08072         66 VELHKKDGDLVKKGEIIATVQ   86 (277)
T ss_pred             EEEEeCCCCEEcCCCEEEEEE
Confidence            577899999999999999875


No 151
>PRK14040 oxaloacetate decarboxylase; Provisional
Probab=34.05  E-value=46  Score=27.45  Aligned_cols=24  Identities=17%  Similarity=0.178  Sum_probs=19.7

Q ss_pred             EEEEecCcEEecCCeEEEEEeehh
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      .++|+.||.|++|++|+++--.+.
T Consensus       537 ~~~V~~Gd~V~~Gd~l~~iEamKm  560 (593)
T PRK14040        537 KVIVTEGQTVAEGDVLLILEAMKM  560 (593)
T ss_pred             EEEeCCCCEeCCCCEEEEEecCce
Confidence            357999999999999999755544


No 152
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=33.93  E-value=47  Score=25.06  Aligned_cols=22  Identities=18%  Similarity=0.102  Sum_probs=18.9

Q ss_pred             CcEEEEecCcEEecCCeEEEEE
Q 042693           18 GAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ....++++|+.|++|++++.+.
T Consensus        66 ~v~~~~~dG~~v~~G~~i~~~~   87 (281)
T PRK06543         66 TVTLAVADGERFEAGDILATVT   87 (281)
T ss_pred             EEEEEeCCCCEecCCCEEEEEE
Confidence            3466899999999999999875


No 153
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=33.87  E-value=44  Score=25.13  Aligned_cols=19  Identities=16%  Similarity=0.148  Sum_probs=17.3

Q ss_pred             EEEecCcEEecCCeEEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~   39 (71)
                      .++++|+.|++|++++++.
T Consensus        76 ~~~~dG~~v~~g~~i~~~~   94 (288)
T PRK07428         76 PLVAEGAACESGQVVAEIE   94 (288)
T ss_pred             EEcCCCCEecCCCEEEEEE
Confidence            6799999999999999875


No 154
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated
Probab=33.84  E-value=50  Score=27.14  Aligned_cols=20  Identities=15%  Similarity=0.137  Sum_probs=14.0

Q ss_pred             EEEecCcEEecCCeEEEEEe
Q 042693           21 SFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~   40 (71)
                      ++++.|+.|..|+.|+.+--
T Consensus        57 i~~~~g~~V~~G~~l~~i~~   76 (633)
T PRK11854         57 IKVKVGDKVETGALIMIFES   76 (633)
T ss_pred             EEeCCCCEEeCCCEEEEEec
Confidence            56677777777777777643


No 155
>PF09891 DUF2118:  Uncharacterized protein conserved in archaea (DUF2118);  InterPro: IPR019217  This entry represents a family of hypothetical proteins of unknown function. ; PDB: 3D4R_D.
Probab=33.35  E-value=30  Score=24.12  Aligned_cols=22  Identities=23%  Similarity=0.315  Sum_probs=14.7

Q ss_pred             EEEecCcEEecCCeEEEEEeeh
Q 042693           21 SFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      +.+..|+.|.+||.||.+...+
T Consensus        94 ~i~~~G~rV~~gd~lA~v~T~K  115 (150)
T PF09891_consen   94 PIVDEGDRVRKGDRLAYVTTRK  115 (150)
T ss_dssp             ESS-TSEEE-TT-EEEEEE-TT
T ss_pred             EEcccCcEeccCcEEEEEEecC
Confidence            4678899999999999887544


No 156
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit. This model describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea. The oxaloacetate decarboxylase Na+ pump is the paradigm of the family of Na+ transport decarboxylases that present in bacteria and archaea. It a multi subunit enzyme consisting of a peripheral alpha-subunit and integral membrane subunits beta and gamma. The energy released by the decarboxylation reaction of oxaloacetate is coupled to Na+ ion pumping across the membrane.
Probab=33.21  E-value=52  Score=27.02  Aligned_cols=24  Identities=17%  Similarity=0.102  Sum_probs=19.9

Q ss_pred             EEEEecCcEEecCCeEEEEEeehh
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      .++|+.||.|++|++|+.+--.|.
T Consensus       530 ~~~V~~Gd~V~~G~~l~~iEamKm  553 (582)
T TIGR01108       530 KVKVSEGQTVAEGEVLLILEAMKM  553 (582)
T ss_pred             EEEeCCCCEECCCCEEEEEEeccc
Confidence            357999999999999998865554


No 157
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=33.21  E-value=46  Score=24.80  Aligned_cols=21  Identities=19%  Similarity=0.219  Sum_probs=18.3

Q ss_pred             cEEEEecCcEEecCCeEEEEE
Q 042693           19 AISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        19 a~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...++.+|+.|++|++++++.
T Consensus        60 ~~~~~~dG~~v~~g~~i~~i~   80 (273)
T PRK05848         60 CVFTIKDGERFKKGDILMEIE   80 (273)
T ss_pred             EEEEcCCCCEecCCCEEEEEE
Confidence            356899999999999999875


No 158
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=33.09  E-value=49  Score=24.93  Aligned_cols=21  Identities=19%  Similarity=0.150  Sum_probs=19.0

Q ss_pred             cEEEEecCcEEecCCeEEEEE
Q 042693           19 AISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        19 a~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...++.+|+.+++|++++++.
T Consensus        72 ~~~~~~dG~~v~~g~~i~~i~   92 (281)
T PRK06106         72 MRRHLPDGAAVAPGDVIATIS   92 (281)
T ss_pred             EEEEeCCCCEEcCCCEEEEEE
Confidence            678899999999999999875


No 159
>PRK05279 N-acetylglutamate synthase; Validated
Probab=32.71  E-value=57  Score=25.04  Aligned_cols=47  Identities=9%  Similarity=0.085  Sum_probs=27.1

Q ss_pred             eCCCcEEEEecCcEEe--cCCeEEEEEeeh----hc---cCCccCc-hhhHhhhhhh
Q 042693           15 ATPGAISFRHYGAFLH--KGNKLVTFIYEK----LR---SCDLTRA-LSKVKQVLEI   61 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~--~G~~L~~l~~e~----~k---t~DItqG-LPkVeeLfEA   61 (71)
                      +-+...++..+-+=|.  .|..+-.+..+.    +.   ++|+++| .|||+..++|
T Consensus       200 l~a~~lv~ltdv~GV~~~~~~~i~~i~~~~~~~~~~~~~~~~~~ggM~~Kv~~a~~~  256 (441)
T PRK05279        200 LKADKLIFFTESQGVLDEDGELIRELSPNEAQALLEALEDGDYNSGTARFLRAAVKA  256 (441)
T ss_pred             cCCCEEEEEECCCCccCCCCchhhhCCHHHHHHHHhhhhcCCCCccHHHHHHHHHHH
Confidence            3344455544433332  355555553221    22   7899988 5999998886


No 160
>PRK02899 adaptor protein; Provisional
Probab=32.70  E-value=39  Score=23.96  Aligned_cols=34  Identities=24%  Similarity=0.317  Sum_probs=26.7

Q ss_pred             cEEecCCeEEEEEeehhccC-----CccCchhhHhhhhh
Q 042693           27 AFLHKGNKLVTFIYEKLRSC-----DLTRALSKVKQVLE   60 (71)
Q Consensus        27 ~~V~~G~~L~~l~~e~~kt~-----DItqGLPkVeeLfE   60 (71)
                      +.|..+++=+++.++-+..+     |+.++=||+++||.
T Consensus         4 ErInentIrv~it~~DL~eRgi~~~dL~~n~~k~e~lF~   42 (197)
T PRK02899          4 ERLNYNKIKIFLTFDDLSERGLTKEDLWRDAPKVHQLFR   42 (197)
T ss_pred             eEccCCeEEEEEeHHHHHHcCCCHHHHhcCcHHHHHHHH
Confidence            45777888888888776654     66789999999983


No 161
>PRK09016 quinolinate phosphoribosyltransferase; Validated
Probab=32.44  E-value=48  Score=25.29  Aligned_cols=21  Identities=10%  Similarity=0.063  Sum_probs=18.7

Q ss_pred             cEEEEecCcEEecCCeEEEEE
Q 042693           19 AISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        19 a~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...++.+|+.|++|++|+.+.
T Consensus        87 v~~~~~dG~~v~~G~~i~~i~  107 (296)
T PRK09016         87 IEWHVDDGDVITANQTLFELT  107 (296)
T ss_pred             EEEEcCCCCEecCCCEEEEEE
Confidence            568899999999999999875


No 162
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating)
Probab=32.42  E-value=51  Score=25.34  Aligned_cols=20  Identities=30%  Similarity=0.260  Sum_probs=17.7

Q ss_pred             EEEEecCcEEecCCeEEEEE
Q 042693           20 ISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ..++.+|+.|++|++++++.
T Consensus        81 ~~~~~dG~~v~~G~~i~~v~  100 (308)
T PLN02716         81 EWAAIDGDFVHKGLKFGKVT  100 (308)
T ss_pred             EEEeCCCCEecCCCEEEEEE
Confidence            46789999999999999875


No 163
>TIGR00761 argB acetylglutamate kinase. This model describes N-acetylglutamate kinases (ArgB) of many prokaryotes and the N-acetylglutamate kinase domains of multifunctional proteins from yeasts. This enzyme is the second step in the "acetylated" ornithine biosynthesis pathway. A related group of enzymes representing the first step of the pathway contain a homologous domain and are excluded from this model.
Probab=31.93  E-value=29  Score=24.16  Aligned_cols=19  Identities=26%  Similarity=0.347  Sum_probs=16.2

Q ss_pred             hccCCccCc-hhhHhhhhhh
Q 042693           43 LRSCDLTRA-LSKVKQVLEI   61 (71)
Q Consensus        43 ~kt~DItqG-LPkVeeLfEA   61 (71)
                      +..+|+++| .||++..++|
T Consensus       202 ~~~~~~tggm~~Kl~~a~~a  221 (231)
T TIGR00761       202 IEQGIITGGMIPKVNAALEA  221 (231)
T ss_pred             HHcCCCCCchHHHHHHHHHH
Confidence            456899998 7999999997


No 164
>PF10199 Adaptin_binding:  Alpha and gamma adaptin binding protein p34;  InterPro: IPR019341  p34 is a protein involved in membrane trafficking. It is known to interact with both alpha and gamma adaptin []. It has been speculated that p34 may play a chaperone role such as preventing the soluble adaptors from co-assembling with soluble clathrin, or helping to remove the adaptors from the coated vesicle. It may also aid in the recruitment of soluble adaptors onto the membrane []. 
Probab=31.81  E-value=26  Score=22.59  Aligned_cols=13  Identities=15%  Similarity=0.470  Sum_probs=11.7

Q ss_pred             CchhhHhhhhhhc
Q 042693           50 RALSKVKQVLEIR   62 (71)
Q Consensus        50 qGLPkVeeLfEAR   62 (71)
                      +|++||-|.|||-
T Consensus         3 ~Gi~Ri~EALeah   15 (137)
T PF10199_consen    3 QGIERIVEALEAH   15 (137)
T ss_pred             ccHHHHHHHHHhC
Confidence            7999999999984


No 165
>PRK05704 dihydrolipoamide succinyltransferase; Validated
Probab=31.14  E-value=61  Score=25.32  Aligned_cols=18  Identities=17%  Similarity=0.119  Sum_probs=11.6

Q ss_pred             EEecCcEEecCCeEEEEE
Q 042693           22 FRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~   39 (71)
                      +++.|+.|..|++|+.+-
T Consensus        60 ~v~~G~~V~~G~~l~~i~   77 (407)
T PRK05704         60 LAEEGDTVTVGQVLGRID   77 (407)
T ss_pred             EeCCCCEeCCCCEEEEEe
Confidence            556666666666666664


No 166
>KOG0559 consensus Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion]
Probab=30.96  E-value=56  Score=26.63  Aligned_cols=20  Identities=20%  Similarity=0.193  Sum_probs=18.0

Q ss_pred             EEEecCcEEecCCeEEEEEe
Q 042693           21 SFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~   40 (71)
                      +.|++||.|+.|+.|+++..
T Consensus       129 ~lvk~gdtV~~g~~la~i~~  148 (457)
T KOG0559|consen  129 LLVKDGDTVTPGQKLAKISP  148 (457)
T ss_pred             EecCCCCcccCCceeEEecC
Confidence            36999999999999999876


No 167
>PLN02226 2-oxoglutarate dehydrogenase E2 component
Probab=30.93  E-value=1.2e+02  Score=24.63  Aligned_cols=38  Identities=13%  Similarity=0.225  Sum_probs=25.8

Q ss_pred             CCCCcEEEEE-------eCCCcEE--EEecCcEEecCCeEEEEEeeh
Q 042693            5 LKSDQILIVQ-------ATPGAIS--FRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus         5 ~~sGqii~i~-------~~~ga~l--~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      +.+|.+..+.       +.+|.++  +++.||.|++|++|+.+--.|
T Consensus        86 ~~~~~m~~i~mP~lg~~~~eG~I~~w~v~~GD~V~~Gq~L~~VEtdK  132 (463)
T PLN02226         86 SESGDTVEAVVPHMGESITDGTLATFLKKPGERVQADEAIAQIETDK  132 (463)
T ss_pred             cccCCceEEecCCCCCCcceEEEEEEEeCCCCEecCCCEEEEEEecc
Confidence            3455554444       5666654  788999999999998764433


No 168
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport. In general, QPRTases are part of the de novo synthesis pathway of NAD in both prokaryotes and eukaryotes. They catalyse the reaction of quinolinic acid (QA) with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to produce nicotinic acid mononucleotide (NAMN), pyrophosphate and carbon dioxide.
Probab=30.86  E-value=53  Score=24.21  Aligned_cols=22  Identities=14%  Similarity=-0.025  Sum_probs=18.5

Q ss_pred             CcEEEEecCcEEecCCeEEEEE
Q 042693           18 GAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ....++.+|+.|++|++++++.
T Consensus        57 ~v~~~~~dG~~v~~g~~i~~i~   78 (272)
T cd01573          57 EVDLAAASGSRVAAGAVLLEAE   78 (272)
T ss_pred             EEEEEcCCCCEecCCCEEEEEE
Confidence            4456789999999999999875


No 169
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=30.79  E-value=54  Score=24.59  Aligned_cols=22  Identities=9%  Similarity=0.116  Sum_probs=18.4

Q ss_pred             CcEEEEecCcEEecCCeEEEEE
Q 042693           18 GAISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        18 ga~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ....++.+|+.|++|++++++-
T Consensus        59 ~v~~~~~dG~~v~~g~~i~~i~   80 (278)
T PRK08385         59 KVEVRKRDGEEVKAGEVILELK   80 (278)
T ss_pred             EEEEEcCCCCEecCCCEEEEEE
Confidence            3455789999999999999875


No 170
>PF01016 Ribosomal_L27:  Ribosomal L27 protein;  InterPro: IPR001684 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. L27 is a protein from the large (50S) subunit; it is essential for ribosome function, but its exact role is unclear. It belongs to a family of ribosomal proteins, examples of which are found in bacteria, chloroplasts of plants and red algae and the mitochondria of fungi (e.g. MRP7 from yeast mitochondria). The schematic relationship between these groups of proteins is shown below.  Bacterial L27 Nxxxxxxxxx Algal L27 Nxxxxxxxxx Plant L27 tttttNxxxxxxxxxxxxx Yeast MRP7 tttNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 't': transit peptide. 'N': N-terminal of mature protein.  ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2ZJQ_T 2ZJP_T 3PIP_T 3DLL_T 3PIO_T 1Y69_U 3CF5_T 2ZJR_T 1VSA_U 3PYT_W ....
Probab=30.52  E-value=43  Score=21.25  Aligned_cols=17  Identities=29%  Similarity=0.440  Sum_probs=14.2

Q ss_pred             EEecCcEEecCCeEEEE
Q 042693           22 FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l   38 (71)
                      -..+|++|.+|++|++-
T Consensus        23 K~~~G~~V~~G~IivRQ   39 (81)
T PF01016_consen   23 KKFGGQFVKAGNIIVRQ   39 (81)
T ss_dssp             SSSTTCEESSTSEEEEB
T ss_pred             EEeCCEEEcCCCEEEEe
Confidence            35689999999999874


No 171
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts. Domain architecture of these NAGS consisted of an N-terminal NAG kinase-like (ArgB) domain (this CD) and a C-terminal NAG synthase, acetyltransferase (ArgA) domain. Both bacterial and plant sequences in this CD have a conserved N-terminal extension; a similar sequence in the NAG kinases of the cyclic arginine-biosynthesis pathway has been implicated in feedback inhibition sensing. Plant sequences also have an N-terminal chloroplast transit peptide and an insert (approx. 70 residues) in the C-terminal region of ArgB. Members of this CD belong to the Amino Acid Kinase Superfamily (AAK).
Probab=30.38  E-value=69  Score=23.41  Aligned_cols=55  Identities=15%  Similarity=0.193  Sum_probs=33.3

Q ss_pred             CCcEEEEE-----------eCCCcEEEEecCcEEe--cCCeEEEEE----eehhccCCc-cCc-hhhHhhhhhh
Q 042693            7 SDQILIVQ-----------ATPGAISFRHYGAFLH--KGNKLVTFI----YEKLRSCDL-TRA-LSKVKQVLEI   61 (71)
Q Consensus         7 sGqii~i~-----------~~~ga~l~v~~G~~V~--~G~~L~~l~----~e~~kt~DI-tqG-LPkVeeLfEA   61 (71)
                      +||++.++           +-+...++..+-+=|.  .|..+-.+.    .+-+..+.+ ++| .|||++.+||
T Consensus       174 ~g~~lnvnaD~~A~~LA~~L~a~klv~ltdv~GV~~~~~~~i~~i~~~e~~~l~~~~~~~~ggM~~Kv~~a~~a  247 (280)
T cd04237         174 TGEVFNLSMEDVATAVAIALKADKLIFLTDGPGLLDDDGELIRELTAQEAEALLETGALLTNDTARLLQAAIEA  247 (280)
T ss_pred             CCCEEeeCHHHHHHHHHHHcCCCEEEEEeCCCcccCCCCCccccCCHHHHHHHHHcCCCCCCCHHHHHHHHHHH
Confidence            46666555           3344455555444333  466666664    334555677 655 6999999997


No 172
>PF00717 Peptidase_S24:  Peptidase S24-like peptidase classification. ;  InterPro: IPR019759 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ].; PDB: 1KCA_H 3BDN_A 1F39_A 1JHH_A 1JHE_B 3JSP_A 1JHF_B 1JHC_A 3JSO_B 1B12_D ....
Probab=29.80  E-value=69  Score=17.63  Aligned_cols=22  Identities=18%  Similarity=0.206  Sum_probs=10.7

Q ss_pred             eCCCcEEEEecCcEEecCCeEE
Q 042693           15 ATPGAISFRHYGAFLHKGNKLV   36 (71)
Q Consensus        15 ~~~ga~l~v~~G~~V~~G~~L~   36 (71)
                      +++|..+.++....+..||.++
T Consensus        11 i~~Gd~v~v~~~~~~~~gdivv   32 (70)
T PF00717_consen   11 IKDGDIVLVDPSSEPKDGDIVV   32 (70)
T ss_dssp             SSTTEEEEEEETS---TTSEEE
T ss_pred             eeCCCEEEEEEcCCCccCeEEE
Confidence            3456666666555555665544


No 173
>cd08607 GDPD_GDE5 Glycerophosphodiester phosphodiesterase domain of putative mammalian glycerophosphodiester phosphodiesterase GDE5 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in putative mammalian GDE5 and similar proteins. Mammalian GDE5 is widely expressed in mammalian tissues, with highest expression in the spinal chord. Although its biological function remains unclear, mammalian GDE5 shows higher sequence homology to fungal and plant  glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46) than to other bacterial and mammalian GP-GDEs. It may also hydrolyze glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. In addition to C-terminal GDPD domain, all members in this subfamily have a starch binding domain (CBM20) in the N-terminus, which suggests these proteins may play a distinct role in glycerol metabolism.
Probab=29.78  E-value=82  Score=22.47  Aligned_cols=50  Identities=22%  Similarity=0.230  Sum_probs=33.6

Q ss_pred             EEeCCCcEEEEecCcEEecCC--------------eEEEEEeehhccCCc----------------------cCchhhHh
Q 042693           13 VQATPGAISFRHYGAFLHKGN--------------KLVTFIYEKLRSCDL----------------------TRALSKVK   56 (71)
Q Consensus        13 i~~~~ga~l~v~~G~~V~~G~--------------~L~~l~~e~~kt~DI----------------------tqGLPkVe   56 (71)
                      ++++....+.|-|-..+..-.              .+..+.++.+++=|.                      -+.+|..+
T Consensus        42 V~lTkDg~~VV~HD~~l~r~~~~~~~~~~~~~~~~~v~~lt~~eL~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~iPtL~  121 (290)
T cd08607          42 VQLTKDLVPVVYHDFTLRVSLKSKGDSDRDDLLEVPVKDLTYEQLKLLKLFHISALKVKEYKSVEEDEDPPEHQPFPTLS  121 (290)
T ss_pred             EEEccCCeEEEEcCCeeEeeccCccccCccceEEEecccCCHHHHhhcCcccccccccccccccccccccccccCCCCHH
Confidence            336666666666666655411              577888888887664                      23589999


Q ss_pred             hhhhhc
Q 042693           57 QVLEIR   62 (71)
Q Consensus        57 eLfEAR   62 (71)
                      |+|+.=
T Consensus       122 evl~~~  127 (290)
T cd08607         122 DVLESV  127 (290)
T ss_pred             HHHHhC
Confidence            999963


No 174
>cd08583 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases. This subfamily corresponds to a group of uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipase C (PI-PLC), and glycerophosphodiester phosphodiesterases (GP-GDE), and also sphingomyelinases D (SMases D) and similar proteins. They hydrolyze the 3'-5' phosphodiester bonds in different substrates, utilizing a similar mechanism of general base and acid catalysis involving two conserved histidine residues.
Probab=29.20  E-value=46  Score=23.09  Aligned_cols=49  Identities=12%  Similarity=0.133  Sum_probs=32.0

Q ss_pred             EEeCCCcEEEEecCcEEe----c----CCeEEEEEeehhccCCcc--CchhhHhhhhhh
Q 042693           13 VQATPGAISFRHYGAFLH----K----GNKLVTFIYEKLRSCDLT--RALSKVKQVLEI   61 (71)
Q Consensus        13 i~~~~ga~l~v~~G~~V~----~----G~~L~~l~~e~~kt~DIt--qGLPkVeeLfEA   61 (71)
                      ++++....+.+.|.+.+.    .    ...+..+.++.++..|.-  ..+|..+|+|+.
T Consensus        36 V~lTkDg~lVv~HD~~~~r~~~~g~~~~~~i~~~t~~el~~~~~~~~~~iptL~evl~~   94 (237)
T cd08583          36 LSLTSDGVLVARHSWDESLLKQLGLPTSKNTKPLSYEEFKSKKIYGKYTPMDFKDVIDL   94 (237)
T ss_pred             eeEccCCCEEEEECCcCchhhhcCCcccccccCCCHHHHhhccccCCCCCCCHHHHHHH
Confidence            346665555555554332    1    224678888888887764  358999999985


No 175
>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component). dihydrolipoamide acetyltransferase. The seed for this model includes mitochondrial and Gram-negative bacterial forms. Mycobacterial candidates are highly derived, differ in having and extra copy of the lipoyl-binding domain at the N-terminus. They score below the trusted cutoff, but above the noise cutoff and above all examples of dihydrolipoamide acetyltransferase.
Probab=28.58  E-value=70  Score=24.99  Aligned_cols=19  Identities=16%  Similarity=0.172  Sum_probs=12.0

Q ss_pred             EEEecCcEEecCCeEEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~   39 (71)
                      ++++.|+.|..|++|+.+-
T Consensus        57 i~~~eG~~v~vG~~l~~i~   75 (403)
T TIGR01347        57 ILFKEGDTVESGQVLAILE   75 (403)
T ss_pred             EEeCCCCEeCCCCEEEEEe
Confidence            3556666666666666664


No 176
>cd08568 GDPD_TmGDE_like Glycerophosphodiester phosphodiesterase domain of Thermotoga maritime and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermotoga maritime glycerophosphodiester phosphodiesterase (TmGDE, EC 3.1.4.46) and its uncharacterized  homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. TmGDE exists as a monomer that might be the biologically relevant form.
Probab=27.99  E-value=96  Score=21.33  Aligned_cols=50  Identities=14%  Similarity=0.137  Sum_probs=34.7

Q ss_pred             EEeCCCcEEEEecCcEEec----CCeEEEEEeehhccCCcc-CchhhHhhhhhhc
Q 042693           13 VQATPGAISFRHYGAFLHK----GNKLVTFIYEKLRSCDLT-RALSKVKQVLEIR   62 (71)
Q Consensus        13 i~~~~ga~l~v~~G~~V~~----G~~L~~l~~e~~kt~DIt-qGLPkVeeLfEAR   62 (71)
                      ++++....+.+.|-+.+..    .-.+..+.|+.+++=|+- +-+|..+|+|+.=
T Consensus        35 V~lT~Dg~~Vv~HD~~l~R~t~~~g~v~~~t~~eL~~l~~~g~~iPtL~evl~~~   89 (226)
T cd08568          35 VWLTKDGKLVVLHDENLKRVGGVDLKVKELTYKELKKLHPGGELIPTLEEVFRAL   89 (226)
T ss_pred             EEEcCCCCEEEECCCcccccCCCCceeecCCHHHHhhCCCCCCcCCCHHHHHHhc
Confidence            3466656666655555533    236788889988887764 4599999999863


No 177
>PF13667 ThiC-associated:  ThiC-associated domain ; PDB: 3EPO_A 3EPN_B 3EPM_B.
Probab=27.88  E-value=28  Score=21.87  Aligned_cols=20  Identities=20%  Similarity=0.356  Sum_probs=10.1

Q ss_pred             cCCccCchhhHh-hhhhhcCC
Q 042693           45 SCDLTRALSKVK-QVLEIRSF   64 (71)
Q Consensus        45 t~DItqGLPkVe-eLfEAR~~   64 (71)
                      .-||-.|||++- +-.++|..
T Consensus        57 ~iDi~~GLp~lR~~WI~~R~D   77 (80)
T PF13667_consen   57 EIDIRKGLPPLREEWIEERGD   77 (80)
T ss_dssp             ---TTT-S--TTHHHHHHTS-
T ss_pred             ccchhcCChHHHHHHHHhcCC
Confidence            358999999986 66777754


No 178
>TIGR01235 pyruv_carbox pyruvate carboxylase. This enzyme plays a role in gluconeogensis but not glycolysis.
Probab=27.44  E-value=1.3e+02  Score=26.87  Aligned_cols=24  Identities=25%  Similarity=0.223  Sum_probs=18.8

Q ss_pred             EEEEecCcEEecCCeEEEEEeehh
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      .++|+.||.|++||+|+.+--.|.
T Consensus      1087 ~~~v~~Gd~V~~Gd~L~~iEamKm 1110 (1143)
T TIGR01235      1087 EVKVSSGQAVNKGDPLVVLEAMKM 1110 (1143)
T ss_pred             EEEeCCCCEeCCCCEEEEEEecce
Confidence            457889999999999998765544


No 179
>PRK09454 ugpQ cytoplasmic glycerophosphodiester phosphodiesterase; Provisional
Probab=27.43  E-value=59  Score=22.91  Aligned_cols=49  Identities=14%  Similarity=0.108  Sum_probs=34.4

Q ss_pred             EEeCCCcEEEEecCcEEec----CCeEEEEEeehhccCCcc---------CchhhHhhhhhh
Q 042693           13 VQATPGAISFRHYGAFLHK----GNKLVTFIYEKLRSCDLT---------RALSKVKQVLEI   61 (71)
Q Consensus        13 i~~~~ga~l~v~~G~~V~~----G~~L~~l~~e~~kt~DIt---------qGLPkVeeLfEA   61 (71)
                      ++++....+.|.|-+.+..    ...+..+.|+.+++=|+-         +.+|..+|+|++
T Consensus        43 V~lT~Dg~lVV~HD~~l~R~t~~~~~v~~~t~~el~~l~~~~~~~~~~~~~~iPtL~evl~~  104 (249)
T PRK09454         43 AKLSADGEIFLLHDDTLERTSNGWGVAGELTWQDLAQLDAGSWFSAAFAGEPLPTLSQVAAR  104 (249)
T ss_pred             eeECCCCCEEEECCCcccccCCCCCchhhCCHHHHHhcCCCCccCCCCCCCcCCCHHHHHHH
Confidence            3466666666666665543    235678889988887763         359999999996


No 180
>PRK14040 oxaloacetate decarboxylase; Provisional
Probab=27.12  E-value=1.3e+02  Score=24.96  Aligned_cols=18  Identities=22%  Similarity=0.266  Sum_probs=16.3

Q ss_pred             EEEecCcEEecCCeEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l   38 (71)
                      ++++.|+.|..|++|+.+
T Consensus       575 i~v~~Gd~V~~G~~L~~I  592 (593)
T PRK14040        575 IAVKEGDAVAVGDTLLTL  592 (593)
T ss_pred             EEeCCCCEECCCCEEEEe
Confidence            578999999999999986


No 181
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional
Probab=27.03  E-value=1.5e+02  Score=23.51  Aligned_cols=20  Identities=20%  Similarity=0.182  Sum_probs=17.5

Q ss_pred             EEEecCcEEecCCeEEEEEe
Q 042693           21 SFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~   40 (71)
                      ++++.|+.|..|++|+.+-.
T Consensus       101 i~v~~G~~V~~G~~L~~I~~  120 (418)
T PTZ00144        101 IFAEEGDTVEVGAPLSEIDT  120 (418)
T ss_pred             EEeCCCCEecCCCEEEEEcC
Confidence            47899999999999999953


No 182
>PRK12999 pyruvate carboxylase; Reviewed
Probab=26.96  E-value=1.2e+02  Score=27.09  Aligned_cols=23  Identities=17%  Similarity=0.151  Sum_probs=16.7

Q ss_pred             EEEEecCcEEecCCeEEEEEeeh
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      .++|+.||.|++|++|+.+--.+
T Consensus      1089 ~i~v~~Gd~V~~G~~L~~leamK 1111 (1146)
T PRK12999       1089 TVLVKEGDEVKAGDPLAVIEAMK 1111 (1146)
T ss_pred             EEEcCCCCEECCCCEEEEEEccc
Confidence            35688888888888888775443


No 183
>TIGR00527 gcvH glycine cleavage system H protein. The genome of Aquifex aeolicus contains one protein scoring above the trusted cutoff and clustering with other bacterial H proteins, and four more proteins clustering together and scoring below the trusted cutoff; it seems doubtful that all of these homologs are authentic H protein. The Chlamydial homolog of H protein is nearly as divergent as the Aquifex outgroup, is not accompanied by P and T proteins, is not included in the seed alignment, and consequently also scores below the trusted cutoff.
Probab=26.73  E-value=86  Score=20.63  Aligned_cols=32  Identities=25%  Similarity=0.255  Sum_probs=23.5

Q ss_pred             CCcEEEEe---cCcEEecCCeEEEEEeehhccCCcc
Q 042693           17 PGAISFRH---YGAFLHKGNKLVTFIYEKLRSCDLT   49 (71)
Q Consensus        17 ~ga~l~v~---~G~~V~~G~~L~~l~~e~~kt~DIt   49 (71)
                      .|.+.+++   -|+.|++|++++++-..+. ..||.
T Consensus        35 lG~i~~v~lp~~G~~v~~g~~~~~IEs~K~-~~~i~   69 (127)
T TIGR00527        35 LGDIVFVELPEVGAEVSAGESCGSVESVKA-ASDIY   69 (127)
T ss_pred             CCCCceeecCCCCCEecCCCEEEEEEEeee-eeeee
Confidence            36777774   7999999999999965553 34543


No 184
>cd04236 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the urea cycle found in animals. Ureogenic NAGS is a mitochondrial enzyme catalyzing the formation of NAG from acetylcoenzyme A and L-glutamate; NAG is an essential allosteric activator of carbamylphosphate synthase I, the first and rate limiting enzyme of the urea cycle. Ureogenic NAGS activity is dependent on the concentration of glutamate (substrate) and arginine (activator). Domain architecture of ureogenic NAGS consists of an N-terminal NAG kinase-like (ArgB) domain (this CD) and a C-terminal DUF619 domain. Members of this CD belong to the protein superfamily, the Amino Acid Kinase Family (AAKF).
Probab=26.60  E-value=1.2e+02  Score=22.58  Aligned_cols=58  Identities=14%  Similarity=0.120  Sum_probs=35.3

Q ss_pred             CCCcEEEEE-----------eCCCcEEEEec-CcEE-ecCCeEEEEEe-e----hhccCCccCch----hhHhhhhhhcC
Q 042693            6 KSDQILIVQ-----------ATPGAISFRHY-GAFL-HKGNKLVTFIY-E----KLRSCDLTRAL----SKVKQVLEIRS   63 (71)
Q Consensus         6 ~sGqii~i~-----------~~~ga~l~v~~-G~~V-~~G~~L~~l~~-e----~~kt~DItqGL----PkVeeLfEAR~   63 (71)
                      .+||++-++           +.+.-.++..+ +... ..|..+-++.- +    -.+.+=|++|.    |||+++|+|=.
T Consensus       165 ~~G~~~NiNaD~~A~~lA~aL~A~KLIfltd~~GV~~~~g~lI~~l~~~~e~~~li~~g~i~gGm~~ki~ki~~~l~~l~  244 (271)
T cd04236         165 SSGRSVSLDSSEVTTAIAKALQPIKVIFLNRSGGLRDQKHKVLPQVHLPADLPSLSDAEWLSETEQNRIQDIATLLNALP  244 (271)
T ss_pred             CCCCEEEECHHHHHHHHHHHcCCCEEEEEeCCcceECCCCCCccccCcHHHHHHHHhCCEEcCCeeechHHHHHHHHhcc
Confidence            456777666           33444444443 3333 24776666663 2    24456688887    99999999843


No 185
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form. This model describes a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and per cent identity (UPGMA) trees. Members of this set include two or three copies of the lipoyl-binding domain. E. coli AceF is a member of this model, while mitochondrial and some other bacterial forms belong to a separate model.
Probab=26.52  E-value=59  Score=26.29  Aligned_cols=24  Identities=17%  Similarity=0.192  Sum_probs=18.5

Q ss_pred             EEEEecCcEEecCCeEEEEEeehh
Q 042693           20 ISFRHYGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        20 ~l~v~~G~~V~~G~~L~~l~~e~~   43 (71)
                      ..+++.||.|++|+.|+.+--.+.
T Consensus       134 ~w~v~~Gd~V~~g~~l~~vetdK~  157 (546)
T TIGR01348       134 EVLVKVGDTVSADQSLITLESDKA  157 (546)
T ss_pred             EEeeCCCCcccCCCeeEEEEecce
Confidence            347889999999999988765544


No 186
>PLN02528 2-oxoisovalerate dehydrogenase E2 component
Probab=26.40  E-value=82  Score=24.65  Aligned_cols=19  Identities=16%  Similarity=0.240  Sum_probs=12.5

Q ss_pred             EEEecCcEEecCCeEEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~   39 (71)
                      ++++.|+.|..|++|+.+.
T Consensus        55 i~v~~G~~v~vG~~l~~i~   73 (416)
T PLN02528         55 INFSPGDIVKVGETLLKIM   73 (416)
T ss_pred             EEeCCCCEeCCCCEEEEEe
Confidence            4556667777777776664


No 187
>PRK13380 glycine cleavage system protein H; Provisional
Probab=26.08  E-value=1.3e+02  Score=20.36  Aligned_cols=26  Identities=27%  Similarity=0.419  Sum_probs=20.0

Q ss_pred             CcEEEEe---cCcEEecCCeEEEEEeehh
Q 042693           18 GAISFRH---YGAFLHKGNKLVTFIYEKL   43 (71)
Q Consensus        18 ga~l~v~---~G~~V~~G~~L~~l~~e~~   43 (71)
                      |.+.+++   .|+.|++|++++++-..+.
T Consensus        44 G~I~~v~lp~~G~~V~~Gd~~~~IEs~K~   72 (144)
T PRK13380         44 GDVVFVRLKELGKKVEKGKPVATLESGKW   72 (144)
T ss_pred             CCEEEEEcCCCCCEeeCCCeEEEEEEcce
Confidence            5555554   6899999999999966555


No 188
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion]
Probab=26.07  E-value=96  Score=27.66  Aligned_cols=26  Identities=31%  Similarity=0.386  Sum_probs=20.4

Q ss_pred             CCcEE--EEecCcEEecCCeEEEEEeeh
Q 042693           17 PGAIS--FRHYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        17 ~ga~l--~v~~G~~V~~G~~L~~l~~e~   42 (71)
                      +|.+|  .|+.|++|++|++|+-|.--+
T Consensus      1114 pG~vieikvk~G~kV~Kgqpl~VLSAMK 1141 (1176)
T KOG0369|consen 1114 PGTVIEIKVKEGAKVKKGQPLAVLSAMK 1141 (1176)
T ss_pred             CCceEEEEEecCceecCCCceEeeecce
Confidence            36555  588999999999999887543


No 189
>PRK05704 dihydrolipoamide succinyltransferase; Validated
Probab=26.07  E-value=1.6e+02  Score=22.96  Aligned_cols=20  Identities=15%  Similarity=0.250  Sum_probs=14.0

Q ss_pred             EEecCcEEecCCeEEEEEee
Q 042693           22 FRHYGAFLHKGNKLVTFIYE   41 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~~e   41 (71)
                      +++.||.|++||.|+.+--.
T Consensus        23 ~v~~Gd~V~~Gd~l~~vEtd   42 (407)
T PRK05704         23 HKKPGDAVKRDEVLVEIETD   42 (407)
T ss_pred             EeCCcCEeCCCCEEEEEEec
Confidence            57777888888887765433


No 190
>PRK14906 DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional
Probab=25.78  E-value=38  Score=31.32  Aligned_cols=36  Identities=14%  Similarity=0.215  Sum_probs=28.9

Q ss_pred             eCCCcEEE--EecCcEEecCCeEEEEEeehhccCCccCchhhHhhhhhhcC
Q 042693           15 ATPGAISF--RHYGAFLHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRS   63 (71)
Q Consensus        15 ~~~ga~l~--v~~G~~V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~   63 (71)
                      +|.++.+.  |++||.|++|+.|             |.|-+-..+||+..-
T Consensus      1061 v~~~~~~~~~v~~gd~v~~G~~l-------------~~G~~~p~~il~~~g 1098 (1460)
T PRK14906       1061 VSARVQFMPGVEDGVEVRVGQQI-------------TRGSVNPHDLLRLTD 1098 (1460)
T ss_pred             ccCCcccccccCCCCEEccCCCc-------------cCCCCCHHHHHHhcC
Confidence            89999999  9999999999986             446666667766543


No 191
>PF10262 Rdx:  Rdx family;  InterPro: IPR011893 This entry represents the Rdx family of selenoproteins, which includes mammalian selenoproteins SelW, SelV, SelT and SelH, bacterial SelW-like proteins and cysteine-containing proteins of unknown function in all three domains of life. Mammalian Rdx12 and its fish selenoprotein orthologues are also members of this family []. These proteins possess a thioredoxin-like fold and a conserved CXXC or CxxU (U is selenocysteine) motif near the N terminus, suggesting a redox function. Rdx proteins can use catalytic cysteine (or selenocysteine) to form transient mixed disulphides with substrate proteins. Selenium (Se) plays an essential role in cell survival and most of the effects of Se are probably mediated by selenoproteins.   Selenoprotein W (SelW) plays an important role in protection of neurons from oxidative stress during neuronal development [], [].   Selenoprotein T (SelT) is conserved from plants to humans. SelT is localized to the endoplasmic reticulum through a hydrophobic domain. The protein binds to UDP-glucose:glycoprotein glucosyltransferase (UGTR), the endoplasmic reticulum (ER)-resident protein, which is known to be involved in the quality control of protein folding [, ]. The function of SelT is unknown, although it may have a role in PACAP signaling during PC12 cell differentiation [, ].  Selenoprotein H (SelH) protects neurons against UVB-induced damage by inhibiting apoptotic cell death pathways, by preventing mitochondrial depolarization, and by promoting cell survival pathways [].; GO: 0008430 selenium binding, 0045454 cell redox homeostasis; PDB: 2OJL_B 2FA8_A 2P0G_C 2NPB_A 3DEX_C 2OKA_A 2OBK_G.
Probab=25.65  E-value=1.1e+02  Score=18.01  Aligned_cols=20  Identities=20%  Similarity=0.521  Sum_probs=16.3

Q ss_pred             EEeehhccCCccCchhhHhhhhhh
Q 042693           38 FIYEKLRSCDLTRALSKVKQVLEI   61 (71)
Q Consensus        38 l~~e~~kt~DItqGLPkVeeLfEA   61 (71)
                      +.|.++++|    |.|-.+|++++
T Consensus        53 lI~SK~~~g----~fP~~~~i~~~   72 (76)
T PF10262_consen   53 LIFSKLESG----RFPDPDEIVQL   72 (76)
T ss_dssp             EEEEHHHHT----SSS-HHHHHHH
T ss_pred             EEEEehhcC----CCCCHHHHHHH
Confidence            788899877    99999999875


No 192
>cd06462 Peptidase_S24_S26 The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families. The S24 LexA protein domains include: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The S26 type I signal peptidase (SPase) family also includes mitochondrial inner membrane protease (IMP)-like members. SPases are essential membrane-bound proteases which function to cleave away the amino-terminal signal peptide from the translocated pre-protein, thus playing a crucial role in the tr
Probab=25.24  E-value=71  Score=17.81  Aligned_cols=21  Identities=10%  Similarity=0.336  Sum_probs=10.1

Q ss_pred             eCCCcEEEEecCcE-EecCCeE
Q 042693           15 ATPGAISFRHYGAF-LHKGNKL   35 (71)
Q Consensus        15 ~~~ga~l~v~~G~~-V~~G~~L   35 (71)
                      ++.|.++.++.... +..|+.+
T Consensus        14 i~~gd~v~i~~~~~~~~~G~iv   35 (84)
T cd06462          14 IPDGDLVLVDKSSYEPKRGDIV   35 (84)
T ss_pred             ccCCCEEEEEecCCCCcCCEEE
Confidence            34455555554444 4444444


No 193
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated
Probab=25.06  E-value=73  Score=26.17  Aligned_cols=17  Identities=18%  Similarity=0.268  Sum_probs=9.1

Q ss_pred             EEecCcEEecCCeEEEE
Q 042693           22 FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l   38 (71)
                      +++.||.|++|++|+.+
T Consensus       225 ~v~~Gd~V~~g~~l~~v  241 (633)
T PRK11854        225 MVKVGDKVEAEQSLITV  241 (633)
T ss_pred             EecCCCeecCCCceEEE
Confidence            44555555555555544


No 194
>PRK12999 pyruvate carboxylase; Reviewed
Probab=24.91  E-value=71  Score=28.39  Aligned_cols=17  Identities=24%  Similarity=0.391  Sum_probs=11.2

Q ss_pred             EEecCcEEecCCeEEEE
Q 042693           22 FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l   38 (71)
                      +++.|+.|..|+.|+++
T Consensus      1128 ~v~~g~~V~~g~~l~~i 1144 (1146)
T PRK12999       1128 LVKAGDQVEAGDLLVEL 1144 (1146)
T ss_pred             EeCCCCEECCCCEEEEE
Confidence            35666777777777665


No 195
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed
Probab=24.84  E-value=85  Score=25.19  Aligned_cols=17  Identities=24%  Similarity=0.307  Sum_probs=10.2

Q ss_pred             EEecCcEEecCCeEEEE
Q 042693           22 FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l   38 (71)
                      +++.||.|++|++|+.+
T Consensus        22 ~v~~Gd~V~~g~~l~~i   38 (547)
T PRK11855         22 LVKEGDTVEEDQPLVTV   38 (547)
T ss_pred             EcCCCCEeCCCCEEEEE
Confidence            45566666666666554


No 196
>PF01538 HCV_NS2:  Hepatitis C virus non-structural protein NS2;  InterPro: IPR002518 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  The group of proteins, non-structural protein 2 (NS2) of hepatitis C virus, are peptidases belonging to MEROPS peptidase family C18 (hepatitis C virus endopeptidase 2, clan CM). The viral genome is translated into a single polyprotein of about 3000 amino acids. Generation of the mature non-structural proteins relies on the activity of viral proteases. NS2 is an zinc-dependent autocatalytic endopeptidase which cleaves at the NS2/NS3 junction [, ]. The action of NS3 proteinase (NS3P, IPR004109 from INTERPRO), which resides in the N-terminal one-third of the NS3 protein, then yields all remaining non-structural proteins. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity; PDB: 2HD0_F 2KWZ_A 2KWT_A.
Probab=24.83  E-value=23  Score=25.95  Aligned_cols=15  Identities=13%  Similarity=0.198  Sum_probs=9.3

Q ss_pred             ehhccCCccCchhhH
Q 042693           41 EKLRSCDLTRALSKV   55 (71)
Q Consensus        41 e~~kt~DItqGLPkV   55 (71)
                      +.+--|||+.|||-+
T Consensus       179 dTaACGdii~GLPVs  193 (195)
T PF01538_consen  179 DTAACGDIIHGLPVS  193 (195)
T ss_dssp             TT--TT-EETTEEEE
T ss_pred             ceecccccccCccCC
Confidence            455568999999954


No 197
>PF01987 AIM24:  Mitochondrial biogenesis AIM24;  InterPro: IPR002838 The proteins in this family have no known function.; PDB: 1PG6_A 1YOX_D.
Probab=24.40  E-value=1.6e+02  Score=20.08  Aligned_cols=30  Identities=17%  Similarity=0.252  Sum_probs=21.6

Q ss_pred             CCCCcEEEEEeCCCcEEEEecCcEEecCCe
Q 042693            5 LKSDQILIVQATPGAISFRHYGAFLHKGNK   34 (71)
Q Consensus         5 ~~sGqii~i~~~~ga~l~v~~G~~V~~G~~   34 (71)
                      -.+.+++.++++++..++++.|.+|.-..-
T Consensus         6 g~~~~~l~v~L~~~~~v~~~~Gsmv~~~g~   35 (215)
T PF01987_consen    6 GPPFSVLSVTLPPGEPVYAEAGSMVAMSGN   35 (215)
T ss_dssp             SSSS-EEEEEE-TT-EEEEECCGEEEEETT
T ss_pred             CCCcEEEEEEECCCCeEEEEcCCEEEEeCC
Confidence            456789999999999999999998764433


No 198
>cd08601 GDPD_SaGlpQ_like Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=24.22  E-value=1.2e+02  Score=21.29  Aligned_cols=49  Identities=12%  Similarity=0.211  Sum_probs=34.1

Q ss_pred             EEeCCCcEEEEecCcEEec------CCeEEEEEeehhccCCcc-----------------CchhhHhhhhhh
Q 042693           13 VQATPGAISFRHYGAFLHK------GNKLVTFIYEKLRSCDLT-----------------RALSKVKQVLEI   61 (71)
Q Consensus        13 i~~~~ga~l~v~~G~~V~~------G~~L~~l~~e~~kt~DIt-----------------qGLPkVeeLfEA   61 (71)
                      ++++....+.+.|...+..      ...+..+.++.++.=|+-                 +.+|..+|+|++
T Consensus        36 V~lTkDg~~Vv~HD~~l~r~t~~~~~g~v~~~t~~el~~l~~~~~~~~~~~~~~~~~~~~~~iptL~evl~~  107 (256)
T cd08601          36 LQMTKDGVLVAMHDETLDRTTNIERPGPVKDYTLAEIKQLDAGSWFNKAYPEYARESYSGLKVPTLEEVIER  107 (256)
T ss_pred             eeECCCCeEEEeCCCccccccCCCCCceeecCcHHHHHhcCCCccccccCccccccccCCccCCCHHHHHHH
Confidence            3367666666666666544      345778888888877762                 458999999985


No 199
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism]
Probab=24.09  E-value=72  Score=27.20  Aligned_cols=19  Identities=21%  Similarity=0.151  Sum_probs=16.5

Q ss_pred             EEecCcEEecCCeEEEEEe
Q 042693           22 FRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~~   40 (71)
                      .|..|+.|.+||+|+.|--
T Consensus       590 ~V~~G~~V~~G~~lvvlEA  608 (645)
T COG4770         590 AVKEGQEVSAGDLLVVLEA  608 (645)
T ss_pred             EecCCCEecCCCeEEEeEe
Confidence            5889999999999998743


No 200
>cd06848 GCS_H Glycine cleavage H-protein. Glycine cleavage H-proteins are part of the glycine cleavage system (GCS) found in bacteria, archea and the mitochondria of eukaryotes. GCS is a multienzyme complex consisting of 4 different components (P-, H-, T- and L-proteins) which catalyzes the oxidative cleavage of glycine. The H-protein shuttles the methylamine group of glycine from the P-protein (glycine dehydrogenase) to the T-protein (aminomethyltransferase) via a lipoyl group, attached to a completely conserved lysine residue.
Probab=24.04  E-value=1.2e+02  Score=18.48  Aligned_cols=25  Identities=24%  Similarity=0.284  Sum_probs=18.9

Q ss_pred             EecCcEEecCCeEEEEEeehhccCCc
Q 042693           23 RHYGAFLHKGNKLVTFIYEKLRSCDL   48 (71)
Q Consensus        23 v~~G~~V~~G~~L~~l~~e~~kt~DI   48 (71)
                      ...|+.|++|+.|+++-..+. +.||
T Consensus        37 ~~~G~~v~~g~~l~~iEs~k~-~~~i   61 (96)
T cd06848          37 PEVGTEVKKGDPFGSVESVKA-ASDL   61 (96)
T ss_pred             cCCCCEEeCCCEEEEEEEccE-EEEE
Confidence            445999999999999976655 3444


No 201
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed
Probab=23.79  E-value=98  Score=23.66  Aligned_cols=16  Identities=13%  Similarity=0.227  Sum_probs=7.6

Q ss_pred             EecCcEEecCCeEEEE
Q 042693           23 RHYGAFLHKGNKLVTF   38 (71)
Q Consensus        23 v~~G~~V~~G~~L~~l   38 (71)
                      ++.|+.|..|++|+.+
T Consensus        61 v~~G~~v~~G~~l~~i   76 (411)
T PRK11856         61 VEEGDVVPVGSVIAVI   76 (411)
T ss_pred             cCCCCEeCCCCEEEEE
Confidence            3444444444444444


No 202
>PF01597 GCV_H:  Glycine cleavage H-protein;  InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes. GCV catalyses the catabolism of glycine in eukaryotes. A lipoyl group is attached to a completely conserved lysine residue. The H protein shuttles the methylamine group of glycine from the P protein to the T protein [].; GO: 0006546 glycine catabolic process, 0005960 glycine cleavage complex; PDB: 3KLR_A 2EDG_A 1ONL_B 2KA7_A 1ZKO_A 3TZU_C 3MXU_A 3A8I_F 3A8J_E 3A7A_B ....
Probab=23.74  E-value=1.5e+02  Score=19.20  Aligned_cols=19  Identities=26%  Similarity=0.401  Sum_probs=13.3

Q ss_pred             ecCcEEecCCeEEEEEeeh
Q 042693           24 HYGAFLHKGNKLVTFIYEK   42 (71)
Q Consensus        24 ~~G~~V~~G~~L~~l~~e~   42 (71)
                      ..|+.+++|++++++-..+
T Consensus        40 ~~g~~~~~g~~~~~ies~k   58 (122)
T PF01597_consen   40 KVGTKLKKGDPFASIESSK   58 (122)
T ss_dssp             -TT-EE-TTSEEEEEEESS
T ss_pred             cCCCEEecCCcEEEEEECc
Confidence            4588999999999997554


No 203
>PLN00208 translation initiation factor (eIF); Provisional
Probab=23.55  E-value=2.2e+02  Score=19.78  Aligned_cols=48  Identities=8%  Similarity=-0.023  Sum_probs=25.7

Q ss_pred             CCCCCCcEEE-EE-eCCCcEEEEecC--c--------------EEecCCeEEE-EEeehhccCCccC
Q 042693            3 THLKSDQILI-VQ-ATPGAISFRHYG--A--------------FLHKGNKLVT-FIYEKLRSCDLTR   50 (71)
Q Consensus         3 ~~~~sGqii~-i~-~~~ga~l~v~~G--~--------------~V~~G~~L~~-l~~e~~kt~DItq   50 (71)
                      ++|..||++. +. +-+++.+.|.+.  .              +|.+||.+.- +.--....+||+.
T Consensus        27 ~~p~egq~~g~V~~~lGn~~~~V~c~dG~~rLa~IpGKmRKrIWI~~GD~VlVel~~~d~~KgdIv~   93 (145)
T PLN00208         27 IFKEDGQEYAQVLRMLGNGRCEALCIDGTKRLCHIRGKMRKKVWIAAGDIILVGLRDYQDDKADVIL   93 (145)
T ss_pred             ccCCCCcEEEEEEEEcCCCEEEEEECCCCEEEEEEeccceeeEEecCCCEEEEEccCCCCCEEEEEE
Confidence            3566777775 22 444555555533  2              4677776654 2222344567774


No 204
>TIGR01235 pyruv_carbox pyruvate carboxylase. This enzyme plays a role in gluconeogensis but not glycolysis.
Probab=23.41  E-value=85  Score=28.02  Aligned_cols=14  Identities=14%  Similarity=0.133  Sum_probs=7.3

Q ss_pred             CCCCCcEEEEEeCC
Q 042693            4 HLKSDQILIVQATP   17 (71)
Q Consensus         4 ~~~sGqii~i~~~~   17 (71)
                      ++.+|.|..+.+..
T Consensus      1079 a~~~G~v~~~~v~~ 1092 (1143)
T TIGR01235      1079 APMPGVIIEVKVSS 1092 (1143)
T ss_pred             cCCCcEEEEEEeCC
Confidence            34556666655333


No 205
>TIGR02712 urea_carbox urea carboxylase. Members of this family are ATP-dependent urea carboxylase, including characterized members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae. The allophanate hydrolase domain of the yeast enzyme is not included in this model and is represented by an adjacent gene in Oleomonas sagaranensis. The fusion of urea carboxylase and allophanate hydrolase is designated urea amidolyase. The enzyme from Oleomonas sagaranensis was shown to be highly active on acetamide and formamide as well as urea.
Probab=22.97  E-value=84  Score=28.04  Aligned_cols=20  Identities=20%  Similarity=0.232  Sum_probs=17.4

Q ss_pred             EEEecCcEEecCCeEEEEEe
Q 042693           21 SFRHYGAFLHKGNKLVTFIY   40 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~~   40 (71)
                      ++|+.||.|++||+|+.+--
T Consensus      1146 ~~v~~Gd~V~~Gd~l~~iEs 1165 (1201)
T TIGR02712      1146 VLVEVGDRVEAGQPLVILEA 1165 (1201)
T ss_pred             EEeCCCCEECCCCEEEEEEe
Confidence            57999999999999998733


No 206
>TIGR03806 chp_HNE_0200 conserved hypothetical protein, HNE_0200 family. The model TIGR03805 describes an uncharacterized protein family that contains repeats associated with the formation of a right-handed helical stack of parallel beta strands, homologous to those found in a number of carbohydrate-binding proteins and sugar hydrolases. This model describes another uncharacterized protein family, found in the same species as TIGR03805 member proteins, usually as the adjacent gene or in a fusion protein. An example is HNE_0200 from Hyphomonas neptunium ATCC 15444. Sometimes two members of this family are with a single member of TIGR03805. The function is unknown.
Probab=22.94  E-value=79  Score=24.19  Aligned_cols=45  Identities=18%  Similarity=0.166  Sum_probs=31.3

Q ss_pred             EEeCCCcEEEEec-CcE-EecCCeEEEEEeehhccCCccCchhhHhhhhhhc
Q 042693           13 VQATPGAISFRHY-GAF-LHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIR   62 (71)
Q Consensus        13 i~~~~ga~l~v~~-G~~-V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR   62 (71)
                      |++|+|..+.+.. |.+ ...|++|+|-+|--..+.|     |.-+.++|-|
T Consensus        44 i~lP~g~~i~~~~~~~~~fPvGTvl~KtF~~p~d~~~-----~~~~~~iETR   90 (317)
T TIGR03806        44 VYVPAGTSATYNAEGVLDFPVGTVLVKTFALPSDLRG-----PTNGRLIETR   90 (317)
T ss_pred             EEcCCCCEEeecCCCCeeCCCCCEEEEEEEecccccC-----CCCCeEEEEE
Confidence            3499999998764 444 5689999988876554333     4556677766


No 207
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional
Probab=22.85  E-value=82  Score=23.95  Aligned_cols=17  Identities=24%  Similarity=0.329  Sum_probs=15.3

Q ss_pred             EecCcEEecCCeEEEEE
Q 042693           23 RHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        23 v~~G~~V~~G~~L~~l~   39 (71)
                      +++|+.+++|++++.+.
T Consensus        79 ~~dG~~v~~G~~i~~v~   95 (290)
T PRK06559         79 FKDGDRLTSGDLVLEII   95 (290)
T ss_pred             CCCCCEecCCCEEEEEE
Confidence            39999999999999875


No 208
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form. This model describes a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and per cent identity (UPGMA) trees. Members of this set include two or three copies of the lipoyl-binding domain. E. coli AceF is a member of this model, while mitochondrial and some other bacterial forms belong to a separate model.
Probab=22.85  E-value=1e+02  Score=24.95  Aligned_cols=19  Identities=21%  Similarity=0.137  Sum_probs=14.3

Q ss_pred             EEEecCcEEecCCeEEEEE
Q 042693           21 SFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        21 l~v~~G~~V~~G~~L~~l~   39 (71)
                      ++++.|+.|..|++|+++-
T Consensus        56 i~~~~Gd~V~~G~~La~i~   74 (546)
T TIGR01348        56 IKVKVGDTLPVGGVIATLE   74 (546)
T ss_pred             EEecCCCEEeccceEEEEe
Confidence            6677777888888888774


No 209
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase. This model represents an Actinobacterial clade of E2 enzyme, a component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle. These proteins have multiple domains including the catalytic domain (pfam00198), one or two biotin domains (pfam00364) and an E3-component binding domain (pfam02817).
Probab=22.14  E-value=1e+02  Score=25.28  Aligned_cols=18  Identities=6%  Similarity=0.196  Sum_probs=11.4

Q ss_pred             EEecCcEEecCCeEEEEE
Q 042693           22 FRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l~   39 (71)
                      +++.||.|++||.|+.+-
T Consensus       156 ~v~~Gd~V~~g~~l~~vE  173 (590)
T TIGR02927       156 LKAVGDKIEVDEPILEVS  173 (590)
T ss_pred             EeCCCCEecCCCEeEEEE
Confidence            566666666666665544


No 210
>cd08565 GDPD_pAtGDE_like Glycerophosphodiester phosphodiesterase domain of putative Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in putative Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase (pAtGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
Probab=21.30  E-value=1.1e+02  Score=21.50  Aligned_cols=51  Identities=10%  Similarity=0.106  Sum_probs=33.4

Q ss_pred             EeCCCcEEEEecCcEEec----CCeEEEEEeehhccCCcc----CchhhHhhhhhhcCC
Q 042693           14 QATPGAISFRHYGAFLHK----GNKLVTFIYEKLRSCDLT----RALSKVKQVLEIRSF   64 (71)
Q Consensus        14 ~~~~ga~l~v~~G~~V~~----G~~L~~l~~e~~kt~DIt----qGLPkVeeLfEAR~~   64 (71)
                      +++....+.+.|...+..    .-.+..+.++.+++=|.-    +.+|..+|+|+.=+.
T Consensus        35 ~~TkDg~~Vv~HD~~l~r~t~~~g~v~~~t~~el~~l~~~~~~~~~iptL~evl~~~~~   93 (235)
T cd08565          35 HLTADGEVVVIHDPTLDRTTHGTGAVRDLTLAERKALRLRDSFGEKIPTLEEVLALFAP   93 (235)
T ss_pred             EEccCCCEEEECCChhhcccCCCCceeeccHHHHhcCCCCCCCCCCCCCHHHHHHHhhc
Confidence            355555555555555432    224777888888877763    559999999997543


No 211
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit. This model represents the NqrA subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria. This oxidoreductase complex functions primarily as a sodium ion pump.
Probab=21.30  E-value=82  Score=25.16  Aligned_cols=20  Identities=15%  Similarity=0.006  Sum_probs=17.5

Q ss_pred             cEEEEecCcEEecCCeEEEE
Q 042693           19 AISFRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        19 a~l~v~~G~~V~~G~~L~~l   38 (71)
                      +.+.|+.||.|..|+.|+.-
T Consensus        41 ~k~~Vk~GD~V~~Gq~I~~~   60 (447)
T TIGR01936        41 PKMKVRPGDKVKAGQPLFED   60 (447)
T ss_pred             CceEeCcCCEEcCCCEeEec
Confidence            46899999999999999853


No 212
>PF02785 Biotin_carb_C:  Biotin carboxylase C-terminal domain;  InterPro: IPR005482  Acetyl-CoA carboxylase is found in all animals, plants, and bacteria and catalyzes the first committed step in fatty acid synthesis. It is a multicomponent enzyme containing a biotin carboxylase activity, a biotin carboxyl carrier protein, and a carboxyltransferase functionality. The "B-domain" extends from the main body of the subunit where it folds into two alpha-helical regions and three strands of beta-sheet. Following the excursion into the B-domain, the polypeptide chain folds back into the body of the protein where it forms an eight-stranded antiparallel beta-sheet. In addition to this major secondary structural element, the C-terminal domain also contains a smaller three-stranded antiparallel beta-sheet and seven alpha-helices []. ; GO: 0016874 ligase activity; PDB: 1W96_B 1W93_A 3VA7_A 2GPW_A 2W70_A 3G8D_A 1DV2_A 2VR1_B 2J9G_B 1DV1_A ....
Probab=21.28  E-value=76  Score=20.47  Aligned_cols=30  Identities=13%  Similarity=0.017  Sum_probs=20.1

Q ss_pred             CCCCCCcEEEEEeCCCcEEEEecCcEEecCCe
Q 042693            3 THLKSDQILIVQATPGAISFRHYGAFLHKGNK   34 (71)
Q Consensus         3 ~~~~sGqii~i~~~~ga~l~v~~G~~V~~G~~   34 (71)
                      -.|.+|.|...+.|.|.-+.+..+  +..|+.
T Consensus        13 F~Ps~G~i~~~~~P~g~gvRvDt~--~~~G~~   42 (107)
T PF02785_consen   13 FLPSPGRITRYSPPGGPGVRVDTG--VYSGYE   42 (107)
T ss_dssp             TEBSSEEESEEE-SSSTTEEEEES--ESTTCE
T ss_pred             CcCCcEEEeEEECCCCCCeeEEec--Cccccc
Confidence            457789888888887777766665  555543


No 213
>PF09160 FimH_man-bind:  FimH, mannose binding;  InterPro: IPR015243 This domain adopts a secondary structure consisting of a beta sandwich, with nine strands arranged in two sheets in a Greek key topology. It is predominantly found in bacterial mannose-specific adhesins, and is capable of binding to D-mannose []. ; PDB: 3MCY_C 1KLF_D 1QUN_L 1KIU_L 3RFZ_D 2VCO_B 1TR7_A 1UWF_A 3JWN_N.
Probab=21.11  E-value=71  Score=22.21  Aligned_cols=21  Identities=24%  Similarity=0.401  Sum_probs=15.2

Q ss_pred             cCcEEecCCeEEEEEeehhcc
Q 042693           25 YGAFLHKGNKLVTFIYEKLRS   45 (71)
Q Consensus        25 ~G~~V~~G~~L~~l~~e~~kt   45 (71)
                      -|-.|++||.||+|..-+.-+
T Consensus       114 ~Gv~I~~G~~iAtl~~~k~~t  134 (147)
T PF09160_consen  114 GGVVINKGDLIATLNMHKTNT  134 (147)
T ss_dssp             SEEEE-TTSEEEEEEEEEEES
T ss_pred             CcEEEeCCCEEEEEEEEEecc
Confidence            355799999999998766543


No 214
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional
Probab=21.07  E-value=1.2e+02  Score=24.30  Aligned_cols=17  Identities=12%  Similarity=0.374  Sum_probs=10.3

Q ss_pred             EEecCcEEecCCeEEEE
Q 042693           22 FRHYGAFLHKGNKLVTF   38 (71)
Q Consensus        22 ~v~~G~~V~~G~~L~~l   38 (71)
                      +++.|+.|++||.|+.+
T Consensus        23 ~v~~Gd~V~~gd~l~~i   39 (464)
T PRK11892         23 LKKEGDKVKSGDVIAEI   39 (464)
T ss_pred             EecCCCEecCCCeEEEE
Confidence            45566666666666655


No 215
>PRK08662 nicotinate phosphoribosyltransferase; Reviewed
Probab=20.88  E-value=1.1e+02  Score=23.43  Aligned_cols=21  Identities=5%  Similarity=0.070  Sum_probs=18.1

Q ss_pred             cEEEEecCcEEecCCeEEEEE
Q 042693           19 AISFRHYGAFLHKGNKLVTFI   39 (71)
Q Consensus        19 a~l~v~~G~~V~~G~~L~~l~   39 (71)
                      ...++.+|+.|.+|++++++-
T Consensus        71 ~v~~~~dG~~v~~g~~il~i~   91 (343)
T PRK08662         71 DVYALPEGTLFDPKEPVMRIE   91 (343)
T ss_pred             EEEEeCCCCEecCCceEEEEE
Confidence            346899999999999999874


No 216
>PF03120 DNA_ligase_OB:  NAD-dependent DNA ligase OB-fold domain;  InterPro: IPR004150 DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This family is a small domain found after the adenylation domain DNA_ligase_N in NAD+-dependent ligases (IPR001679 from INTERPRO). OB-fold domains generally are involved in nucleic acid binding.; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 2OWO_A 1TAE_A 3UQ8_A 1DGS_A 1V9P_B 3SGI_A.
Probab=20.04  E-value=23  Score=22.24  Aligned_cols=29  Identities=17%  Similarity=0.330  Sum_probs=16.3

Q ss_pred             EecCCeEEEEEeehhccCCccCchhhHhhhhhhcCCc
Q 042693           29 LHKGNKLVTFIYEKLRSCDLTRALSKVKQVLEIRSFD   65 (71)
Q Consensus        29 V~~G~~L~~l~~e~~kt~DItqGLPkVeeLfEAR~~~   65 (71)
                      |..||.+.     -.|+|||+   |||++....+++.
T Consensus        50 i~~Gd~V~-----V~raGdVI---P~I~~vv~~~r~~   78 (82)
T PF03120_consen   50 IRIGDTVL-----VTRAGDVI---PKIVGVVKEKRTG   78 (82)
T ss_dssp             -BBT-EEE-----EEEETTTE---EEEEEE-GGG--S
T ss_pred             CCCCCEEE-----EEECCCcc---ceEeEeehhcCCC
Confidence            45565553     34688865   9999988766553


Done!