BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042701
         (1075 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q18221|SET2_CAEEL Probable histone-lysine N-methyltransferase set-2 OS=Caenorhabditis
           elegans GN=set-2 PE=2 SV=2
          Length = 1507

 Score = 35.4 bits (80), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 3/37 (8%)

Query: 104 PPRR-APPPITVLTPPPVPVTVPPPAFAPS--PIVSA 137
           PP+  APPPIT   PP    + PPP F P+  PI +A
Sbjct: 587 PPQHMAPPPITTSLPPFCDFSQPPPGFTPTFKPITNA 623


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.318    0.135    0.385 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 396,873,410
Number of Sequences: 539616
Number of extensions: 17514907
Number of successful extensions: 80554
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 83
Number of HSP's successfully gapped in prelim test: 226
Number of HSP's that attempted gapping in prelim test: 75626
Number of HSP's gapped (non-prelim): 4029
length of query: 1075
length of database: 191,569,459
effective HSP length: 128
effective length of query: 947
effective length of database: 122,498,611
effective search space: 116006184617
effective search space used: 116006184617
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)