Citrus Sinensis ID: 042742


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830----
MPSMHRSGSRPQLDLSKAAIQGNFEVKNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQSIDDKRKKTIKERLGISNGNRRSYPILGGRLHFVKFETTKISECLDFIHSKQLHRGGIHATGGGAYKFADLFKERLGVSLDKEDEMDCLVAGANFLLKAIRHEAFTHMEGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQRGDNRDHRHIGLSASTIASSFGKTISDKKELADYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLDDLMVHQLVERFPMGAPYTGGRIHGPPLGDLNEKISWMEKFVLKGTEITAPVPMAPSGTTGLGGFEVPLSKGSTLRSDASALNVGVLHLVPTLEVFPLLADPKMYEPNTIDLADRSELEYWFTVLSEHLPDLVDKAVASEGGTDDAKRRGDAFARAFSAHLARLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLVELDSMSKETRLLMLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKERMLGSGDNKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDITAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTLDGSKENSPSVPLMVVENGCGSPCIDLRQVSSELAAAAKNADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAEKLIKGNIYDCVCRYEPAR
cccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEEECccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHcccccccEEECcccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccEEEEEEEccccEEEEcccccccHHHHHHHHHHcccccHHHHHHHccccccccccccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHcccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHccccccHHHHHHHHHHHccccccccccHHHHHHHHccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEccccccccccccccHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHccHHHHHHHccccEEEEEEEEcccc
**********************NFEVKNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHE*****************ISNGNRRSYPILGGRLHFVKFETTKISECLDFIHSKQLHRGGIHATGGGAYKFADLFKERLGVSLDKEDEMDCLVAGANFLLKAIRHEAFTHMEGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQRGDNRDHRHIGLSASTIASSFGK*******LADYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLDDLMVHQLVERFPMGAPYTGGRIHGPPLGDLNEKISWMEKFVLKGTEITAPVPMA***TTGLGGFEVPL********DASALNVGVLHLVPTLEVFPLLADPKMYEPNTIDLADRSELEYWFTVLSEHLPDLVDKAV***********RGDAFARAFSAHLARLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLVELDSMSKETRLLMLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKERMLGSGDNKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDITAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTLD****NSPSVPLMVVENGCGSPCIDLRQVSSELAAAAKNADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAEKLIKGNIYDCVCRYEPA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSMHRSGSRPQLDLSKAAIQGNFEVKNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHEDQSIDDKRKKTIKERLGISNGNRRSYPILGGRLHFVKFETTKISECLDFIHSKQLHRGGIHATGGGAYKFADLFKERLGVSLDKEDEMDCLVAGANFLLKAIRHEAFTHMEGQKEFVQIDTNDLFPYLLVNIGSGVSMIKVDGDGKFERVSGTNVGGGTYWGLGRLLTKCKSFDELLELSQRGDNRDHRHIGLSASTIASSFGKTISDKKELADYRPEDISLSLLRMISYNIGQISYLNALRFGLKRIFFGGFFIRGHAYTMDTISFAVQFWSKGEAQAMFLRHEGFLGALGAFMSYEKHGLDDLMVHQLVERFPMGAPYTGGRIHGPPLGDLNEKISWMEKFVLKGTEITAPVPMAPSGTTGLGGFEVPLSKGSTLRSDASALNVGVLHLVPTLEVFPLLADPKMYEPNTIDLADRSELEYWFTVLSEHLPDLVDKAVASEGGTDDAKRRGDAFARAFSAHLARLMEEPAAYGKLGLANLLELREECLREFQFLDAYRSIKQRENEASLAVLPDLLVELDSMSKETRLLMLIEGVLAANIFDWGSRACVDLYHKGTIIEIYRMSRNKMQRPWRVDDFDAFKERMLGSGDNKPRPHKRALLFVDNSGADVVLGMLPLARELLRRGTEVVLVANSLPALNDITAMELPDIVAEAAKHCDILRRAAEAGGLLVDAMINTLDGSKENSPSVPLMVVENGCGSPCIDLRQVSSELAAAAKNADLIILEGMGRALHTNFNARFKCEALKLAMVKNQRLAEKLIKGNIYDCVCRYEPAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pantothenate kinase 2 Plays a role in the physiological regulation of the intracellular CoA concentration.confidentQ8L5Y9
Pantothenate kinase 4 Plays a role in the physiological regulation of the intracellular CoA concentration.probableQ923S8
Pantothenate kinase 4 Plays a role in the physiological regulation of the intracellular CoA concentration.probableQ9NVE7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.33Pantothenate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XFI, chain A
Confidence level:very confident
Coverage over the Query: 455-603,619-722,745-833
View the alignment between query and template
View the model in PyMOL
Template: 2I7N, chain A
Confidence level:very confident
Coverage over the Query: 40-111,122-359
View the alignment between query and template
View the model in PyMOL