Citrus Sinensis ID: 042771


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFTEYLRRAEEIRAVLDDGGPGPAHNGDAAVATRPKTKPKDGGDGGGGDGEDPEQAKLRAGLNSAIIREKPNVKWNDVAGLESAKQALQEAVILPVKFPQFFTGKRQPWRAFLLYGPPGTGKSYLAKAVATEADSTFFSISSSDLVSKWMGESEKLVSSLFQMARESAPSIIFIDEIDSLCGQRGEGNESEASRRIKTELLVQMQGVGHNDQKVLVLAATNTPYALDQAIRRRFDKRIYIPLPDLKARQHMFKVHLGDTPHNLTESDFESLARKTEGFSGSDISVCVKDVLFEPVRKTQDAMFFFKTSNGMWMPCGPKQSGAVQISMQELAAKGLAEQILPPPISKTDFDKVLARQRPTVSKSDLEVQERFTKEFGEEG
ccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEccccccHHHHHHHHHHHcccCEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEHHHHHccccccccccHHHHHHHHHHHHHHccccccccEEEEEEEccccccccHHHHHccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccc
***N*KEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFTEYLRRAEEIRAV******************************************LRAGLNSAIIREKPNVKWNDVAGLESAKQALQEAVILPVKFPQFFTGKRQPWRAFLLYGPPGTGKSYLAKAVATEADSTFFSISSSDLVSKWMGESEKLVSSLFQMARESAPSIIFIDEIDSLCG**************KTELLVQMQGVGHNDQKVLVLAATNTPYALDQAIRRRFDKRIYIPLPDLKARQHMFKVHLGDTPHNLTESDFESLARKTEGFSGSDISVCVKDVLFEPVRKTQDAMFFFKTSNGMWMPCGPK****VQI*************ILPPPISKTDFDKVLARQRPTVSKSDLEVQERFTKEFGE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSNFKEQAIEYVKQAVQEDNAGNYAKAFPLYMNALEYFKTHLKYEKNPKIKEAITQKFTEYLRRAEEIRAVLDDGGPGPAHNGDAAVATRPKTKPKDGGDGGGGDGEDPEQAKLRAGLNSAIIREKPNVKWNDVAGLESAKQALQEAVILPVKFPQFFTGKRQPWRAFLLYGPPGTGKSYLAKAVATEADSTFFSISSSDLVSKWMGESEKLVSSLFQMARESAPSIIFIDEIDSLCGQRGEGNESEASRRIKTELLVQMQGVGHNDQKVLVLAATNTPYALDQAIRRRFDKRIYIPLPDLKARQHMFKVHLGDTPHNLTESDFESLARKTEGFSGSDISVCVKDVLFEPVRKTQDAMFFFKTSNGMWMPCGPKQSGAVQISMQELAAKGLAEQILPPPISKTDFDKVLARQRPTVSKSDLEVQERFTKEFGEEG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 4 Involved in the transport of biosynthetic membrane proteins from the prevacuolar/endosomal compartment to the vacuole. Required for multivesicular body (MVB) protein sorting. Catalyzes the ATP-dependent dissociation of class E VPS proteins from endosomal membranes, such as the disassembly of the ESCRT-III complex.probableP52917
Vacuolar protein sorting-associated protein 4A Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Involved in cytokinesis.probableQ8VEJ9
Vacuolar protein sorting-associated protein 4B Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (lentiviruses). Involved in cytokinesis.probableQ0VD48

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QP9, chain X
Confidence level:very confident
Coverage over the Query: 129-433
View the alignment between query and template
View the model in PyMOL
Template: 2ZAN, chain A
Confidence level:very confident
Coverage over the Query: 123-436
View the alignment between query and template
View the model in PyMOL