BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042797
         (66 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q9C9Z5|NDUA1_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
          OS=Arabidopsis thaliana GN=At3g08610 PE=3 SV=1
          Length = 65

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 47/65 (72%)

Query: 1  MSWLIYEGLLLLGIIAVMLTIAGNAQYHIHKVAYEHLKHIGNNMWDLTMEKRDKKLIEQP 60
          MS +  E +L LGII  ML I GN+QY+IHK  +   KHIG++ WD+ ME+RDKK++E+ 
Sbjct: 1  MSLVWLEAMLPLGIIGGMLCIMGNSQYYIHKAYHGRPKHIGHDEWDVAMERRDKKVVEKA 60

Query: 61 SSASS 65
          ++ SS
Sbjct: 61 AAPSS 65


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.319    0.133    0.399 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 24,880,855
Number of Sequences: 539616
Number of extensions: 758636
Number of successful extensions: 1477
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1476
Number of HSP's gapped (non-prelim): 1
length of query: 66
length of database: 191,569,459
effective HSP length: 38
effective length of query: 28
effective length of database: 171,064,051
effective search space: 4789793428
effective search space used: 4789793428
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)