Citrus Sinensis ID: 042797


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60------
MSWLIYEGLLLLGIIAVMLTIAGNAQYHIHKVAYEHLKHIGNNMWDLTMEKRDKKLIEQPSSASSN
ccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccc
**WLIYEGLLLLGIIAVMLTIAGNAQYHIHKVAYEHLKHIGNNMWDLTME****************
xxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWLIYEGLLLLGIIAVMLTIAGNAQYHIHKVAYEHLKHIGNNMWDLTMEKRDKKLIEQPSSASSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.probableQ9C9Z5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V54, chain D
Confidence level:probable
Coverage over the Query: 9-55
View the alignment between query and template
View the model in PyMOL