Citrus Sinensis ID: 042798

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
VHIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEGEEEEEMNEDREIGALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRTIW
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccccccccccccccEEEccccEEEEEHHHHcccccccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHccEEEEEcccccEEEccEEEEccccEEEEEEEEccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHcHHHHHHccHHHHHHHHHHccccccccEccccccccccccccEcccccEEEEEEEEEccccccccccccccccHcccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccEEEEEEccccc
VHIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMvegeeeeemnedreigalrrndtfLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNRMVYLHAALCEtlrlyppvpynhkiaaqadvlpsghrinkNHSILISYYAMGRMeeiwgkdclefkpqrwisergsivhvpsykftafhagprnclgkdTAFIQMKMVAALILGNYQVkivqghpvspcnsmvlhmkyGLKVQLSKRTIW
vhigkekelskamktFDRFLYECISLKRERLLisrkasteeefDVLTAfmvegeeeeemnedREIGALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNRMVYLHAALCETLRLYPPVPYNHKIAAQAdvlpsghriNKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLhmkyglkvqlskrtiw
VHIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVegeeeeemnedreIGALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRTIW
*************KTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMV***************ALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQL******
VHIGKEKELSKAMKTFDRFLYECI********************VLTAFMVEGEE***********ALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRTIW
VHIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEG*********REIGALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRTIW
VHIGKEKELSKAMKTFDRFLYECISLKRERLLISR*ASTEEEFDVLTAFMVEGEE*************RRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VHIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEGEEEEEMNEDREIGALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRTIW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query271 2.2.26 [Sep-21-2011]
Q9FMY1559 Cytochrome P450 86B1 OS=A no no 0.948 0.459 0.414 1e-57
O23066553 Cytochrome P450 86A2 OS=A no no 0.940 0.461 0.394 1e-55
P48422513 Cytochrome P450 86A1 OS=A no no 0.907 0.479 0.381 1e-47
P98188513 Cytochrome P450 94A2 OS=V N/A no 0.937 0.495 0.361 5e-46
Q50EK3518 Cytochrome P450 704C1 OS= N/A no 0.937 0.490 0.340 2e-44
O81117514 Cytochrome P450 94A1 OS=V N/A no 0.915 0.482 0.368 1e-42
P85191155 Cytochrome P450 (Fragment N/A no 0.431 0.754 0.449 4e-25
Q43068544 Cytochrome P450 82A1 (Fra N/A no 0.837 0.417 0.279 7e-22
Q9Y758519 Cytochrome P450 52A13 OS= yes no 0.708 0.369 0.309 9e-22
P30607522 Cytochrome P450 52A2 OS=C N/A no 0.608 0.316 0.314 2e-21
>sp|Q9FMY1|C86B1_ARATH Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 Back     alignment and function desciption
 Score =  223 bits (567), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 169/292 (57%), Gaps = 35/292 (11%)

Query: 1   VHIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEGEEEEEMN 60
           + IG EK+L +++K  D F  E I  +++ L  S +  T +  D+LT FM   +E+ E  
Sbjct: 264 LDIGTEKKLKESIKGVDDFADEVIRTRKKEL--SLEGETTKRSDLLTVFMGLRDEKGESF 321

Query: 61  EDREIGALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEM----- 115
            D+          FLRD   N + AG++T S  L WFFWL+  +P VE KI+ EM     
Sbjct: 322 SDK----------FLRDICVNFILAGRDTSSVALSWFFWLLEKNPEVEEKIMVEMCKILR 371

Query: 116 ---------KANM--------VNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHR 158
                    K++         + +M YL AAL E LRLYP VP +HK   + DV P G  
Sbjct: 372 QRDDHGNAEKSDYEPVFGPEEIKKMDYLQAALSEALRLYPSVPVDHKEVQEDDVFPDGTM 431

Query: 159 INKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLG 218
           + K   ++ + YAMGRME IWGKDCLEF+P+RW+ + G  +   +YKFTAF+ GPR CLG
Sbjct: 432 LKKGDKVIYAIYAMGRMEAIWGKDCLEFRPERWLRD-GRFMSESAYKFTAFNGGPRLCLG 490

Query: 219 KDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRTI 270
           KD A+ QMK  AA I+  Y+VK+V GH V P  ++ ++MK+GL V L  R++
Sbjct: 491 KDFAYYQMKSTAAAIVYRYKVKVVNGHKVEPKLALTMYMKHGLMVNLINRSV 542
Involved in very long chain fatty acids (VLCFA) omega-hydroxylation. Required for the synthesis of saturated VLCFA alpha, omega-bifunctional suberin monomers.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O23066|C86A2_ARATH Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=2 SV=1 Back     alignment and function description
>sp|P48422|C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 Back     alignment and function description
>sp|P98188|C94A2_VICSA Cytochrome P450 94A2 OS=Vicia sativa GN=CYP94A2 PE=2 SV=1 Back     alignment and function description
>sp|Q50EK3|C04C1_PINTA Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 Back     alignment and function description
>sp|O81117|C94A1_VICSA Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 Back     alignment and function description
>sp|P85191|CP450_HELAN Cytochrome P450 (Fragment) OS=Helianthus annuus PE=1 SV=1 Back     alignment and function description
>sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y758|CP52M_DEBHN Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 Back     alignment and function description
>sp|P30607|CP52B_CANTR Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
224128272 519 cytochrome P450 [Populus trichocarpa] gi 0.963 0.502 0.551 2e-85
359488805 508 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.966 0.515 0.548 2e-85
255560922 509 cytochrome P450, putative [Ricinus commu 0.963 0.512 0.536 2e-84
224135989 508 predicted protein [Populus trichocarpa] 0.981 0.523 0.505 7e-83
224080988 480 cytochrome P450 [Populus trichocarpa] gi 0.974 0.55 0.503 2e-82
255560926 505 cytochrome P450, putative [Ricinus commu 0.963 0.516 0.503 2e-82
356573349 502 PREDICTED: cytochrome P450 86B1-like [Gl 0.944 0.509 0.542 1e-80
356513967 502 PREDICTED: cytochrome P450 86B1-like [Gl 0.944 0.509 0.526 5e-80
224080992 518 predicted protein [Populus trichocarpa] 0.974 0.509 0.498 1e-79
356573353 501 PREDICTED: cytochrome P450 86B1-like [Gl 0.944 0.510 0.517 2e-79
>gi|224128272|ref|XP_002329123.1| cytochrome P450 [Populus trichocarpa] gi|222869792|gb|EEF06923.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  322 bits (824), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 161/292 (55%), Positives = 210/292 (71%), Gaps = 31/292 (10%)

Query: 1   VHIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEE--------EFDVLTAFMVE 52
           + IG+EK+LS+A++TFD+F+Y+CIS + E++L   KA  E         +FD+LTA++  
Sbjct: 234 LQIGEEKKLSRALQTFDQFMYKCISTRCEQVLNENKAKMENIVEEKEAADFDLLTAYI-- 291

Query: 53  GEEEEEMNEDREIGALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKIL 112
              + +M E     A   ++ FLRDTA NLL AG++T S+GLVWFFWLVA HP VE+KIL
Sbjct: 292 ---KVQMKEHGNSAA--SSNKFLRDTATNLLVAGRDTPSAGLVWFFWLVAEHPLVESKIL 346

Query: 113 EEMKA-NMV---------------NRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSG 156
           EE++A N+V               N +VYLHAA+CETLRLYP V  NHK A + D LPSG
Sbjct: 347 EEIRAANLVKEKDGKLRVFSAEEVNGLVYLHAAMCETLRLYPSVHTNHKAAVEEDTLPSG 406

Query: 157 HRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNC 216
           HRI +   +LIS+Y+MGRME IWGKDCLEFKP+RWIS++G I+HVP YKF AF+ GPR C
Sbjct: 407 HRIRRKMQVLISFYSMGRMEAIWGKDCLEFKPERWISDKGGIIHVPPYKFAAFNDGPRTC 466

Query: 217 LGKDTAFIQMKMVAALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKR 268
           LGKD +FIQMKMVA  +L NY V++V+GH V P  ++VLHMK GLKV+++KR
Sbjct: 467 LGKDVSFIQMKMVACAVLWNYHVQVVEGHQVFPSVAVVLHMKNGLKVRITKR 518

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359488805|ref|XP_003633824.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560922|ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis] gi|223539373|gb|EEF40964.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224135989|ref|XP_002322211.1| predicted protein [Populus trichocarpa] gi|222869207|gb|EEF06338.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224080988|ref|XP_002306255.1| cytochrome P450 [Populus trichocarpa] gi|222855704|gb|EEE93251.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255560926|ref|XP_002521476.1| cytochrome P450, putative [Ricinus communis] gi|223539375|gb|EEF40966.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356573349|ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max] Back     alignment and taxonomy information
>gi|356513967|ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max] Back     alignment and taxonomy information
>gi|224080992|ref|XP_002306257.1| predicted protein [Populus trichocarpa] gi|222855706|gb|EEE93253.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356573353|ref|XP_003554826.1| PREDICTED: cytochrome P450 86B1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
TAIR|locus:2122477516 CYP96A9 ""cytochrome P450, fam 0.557 0.292 0.582 2.6e-63
TAIR|locus:2206470497 CYP96A15 ""cytochrome P450, fa 0.955 0.521 0.457 3e-62
TAIR|locus:2206295503 CYP96A3 ""cytochrome P450, fam 0.959 0.516 0.442 7.9e-62
TAIR|locus:2058558516 CYP96A1 ""cytochrome P450, fam 0.970 0.509 0.423 1.3e-61
TAIR|locus:2052526510 CYP96A5 ""cytochrome P450, fam 0.955 0.507 0.440 9e-61
TAIR|locus:2015408520 CYP96A8 ""cytochrome P450, fam 0.959 0.5 0.441 2.7e-59
TAIR|locus:2156677502 CYP96A4 ""cytochrome P450, fam 0.959 0.517 0.429 4e-58
TAIR|locus:2116550506 CYP96A2 ""cytochrome P450, fam 0.963 0.515 0.426 6.6e-58
TAIR|locus:2122506469 CYP96A11 ""cytochrome P450, fa 0.952 0.550 0.420 1.2e-56
TAIR|locus:2122491519 CYP96A10 ""cytochrome P450, fa 0.988 0.516 0.401 9.9e-54
TAIR|locus:2122477 CYP96A9 ""cytochrome P450, family 96, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 516 (186.7 bits), Expect = 2.6e-63, Sum P(2) = 2.6e-63
 Identities = 88/151 (58%), Positives = 115/151 (76%)

Query:   120 VNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIW 179
             V ++VYLH A+CE LRLYPPVP+NHK  A+ DVLPSGH++  N  IL   Y++GRM+ +W
Sbjct:   365 VKKLVYLHGAVCEALRLYPPVPFNHKSPAKPDVLPSGHKVKANSRILFCLYSLGRMKSVW 424

Query:   180 GKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQV 239
             G+D +EFKP+RWISE G  VH PSYKF +F+AGPR CLGK+ A  QMK VA  I+ NY +
Sbjct:   425 GEDAMEFKPERWISESGRSVHEPSYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYDI 484

Query:   240 KIVQGHPVSPCNSMVLHMKYGLKVQLSKRTI 270
              +V+GH + P  S++LHMK+GLKV +SKR +
Sbjct:   485 NVVEGHKIKPAPSVILHMKHGLKVTVSKRCL 515
GO:0005506 "iron ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
TAIR|locus:2206470 CYP96A15 ""cytochrome P450, family 96, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206295 CYP96A3 ""cytochrome P450, family 96, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058558 CYP96A1 ""cytochrome P450, family 96, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052526 CYP96A5 ""cytochrome P450, family 96, subfamily A, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015408 CYP96A8 ""cytochrome P450, family 96, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156677 CYP96A4 ""cytochrome P450, family 96, subfamily A, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116550 CYP96A2 ""cytochrome P450, family 96, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122506 CYP96A11 ""cytochrome P450, family 96, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122491 CYP96A10 ""cytochrome P450, family 96, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13.88LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 2e-83
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 3e-67
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 1e-63
pfam00067461 pfam00067, p450, Cytochrome P450 4e-36
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 3e-27
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-26
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 4e-26
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 4e-22
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-20
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 2e-19
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 5e-17
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 5e-15
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-12
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 7e-12
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-11
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 4e-11
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-09
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-08
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-08
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 3e-08
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 4e-06
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 2e-05
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information 
 Score =  258 bits (660), Expect = 2e-83
 Identities = 123/272 (45%), Positives = 175/272 (64%), Gaps = 16/272 (5%)

Query: 3   IGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEGEEEEEMNED 62
           IG E+++  A+ T +R   + IS +R+   ISR  +     D LT +M         N D
Sbjct: 238 IGLERKMRTALATVNRMFAKIISSRRKEE-ISRAETEPYSKDALTYYM---------NVD 287

Query: 63  REIGALRR--NDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMV 120
                L +   D F+RD  F+L+ AG++T SS L WFFWL++ HP V  KI  E+     
Sbjct: 288 TSKYKLLKPKKDKFIRDVIFSLVLAGRDTTSSALTWFFWLLSKHPQVMAKIRHEINTKFD 347

Query: 121 N----RMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRME 176
           N    ++VYLHAAL E++RLYPP+P+NHK  A+ DVLPSGH+++    I+I  YA+GRM 
Sbjct: 348 NEDLEKLVYLHAALSESMRLYPPLPFNHKAPAKPDVLPSGHKVDAESKIVICIYALGRMR 407

Query: 177 EIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGN 236
            +WG+D L+FKP+RWIS+ G + H PSYKF AF++GPR CLGK  A +QMK+VA  I+ N
Sbjct: 408 SVWGEDALDFKPERWISDNGGLRHEPSYKFMAFNSGPRTCLGKHLALLQMKIVALEIIKN 467

Query: 237 YQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKR 268
           Y  K+++GH +    S++L MK+GLKV ++K+
Sbjct: 468 YDFKVIEGHKIEAIPSILLRMKHGLKVTVTKK 499

Length = 500
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 271
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02966502 cytochrome P450 83A1 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 100.0
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information 
Probab=100.00  E-value=1.4e-52  Score=387.02  Aligned_cols=258  Identities=45%  Similarity=0.858  Sum_probs=217.2

Q ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCcchhhHHHHHHhcCchhhhhhhhhhhcccCCChHHHHHHHHHH
Q 042798            3 IGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEGEEEEEMNEDREIGALRRNDTFLRDTAFNL   82 (271)
Q Consensus         3 ~~~~~~~~~a~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~   82 (271)
                      ++..+++.++.+.+.+++.++|+++++...+.. .......|+++.|++....+.       .....++++++.+++.++
T Consensus       238 ~~~~~~~~~~~~~~~~~~~~~I~~r~~~~~~~~-~~~~~~~d~l~~ll~~~~~~~-------~~~~~~~~~~i~~~~~~~  309 (500)
T PLN02169        238 IGLERKMRTALATVNRMFAKIISSRRKEEISRA-ETEPYSKDALTYYMNVDTSKY-------KLLKPKKDKFIRDVIFSL  309 (500)
T ss_pred             CchhhHHHHHHHHHHHHHHHHHHHHHHHhhccc-cccCCCcCHHHHHHhcccccc-------ccccCCChHHHHHHHHHH
Confidence            345677889999999999999999876432110 001224689999997542110       001135788999999999


Q ss_pred             HhcCccchHHHHHHHHHHHhcChHHHHHHHHHHHHHh----hcCcHHHHHHHHhhccCCCCCCCcccccccceeccCCee
Q 042798           83 LAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANM----VNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHR  158 (271)
Q Consensus        83 ~~ag~~tt~~~l~~~l~~L~~~p~~~~~l~~Ei~~~~----~~~l~~l~~~i~E~lRl~~~~~~~~r~~~~~~~~~~g~~  158 (271)
                      ++||+|||+++++|++++|++||++|+|+++|+++++    +.+|||+++||+|+||+||+++...|+++.+++.++|+.
T Consensus       310 l~AG~dTTa~tl~w~l~~La~~Pevq~kl~~Ei~~v~~~~dl~~L~Yl~avi~EtLRl~P~vp~~~r~~~~d~~~~~G~~  389 (500)
T PLN02169        310 VLAGRDTTSSALTWFFWLLSKHPQVMAKIRHEINTKFDNEDLEKLVYLHAALSESMRLYPPLPFNHKAPAKPDVLPSGHK  389 (500)
T ss_pred             HHhchhHHHHHHHHHHHHHHCCHHHHHHHHHHHHhhCCHHHHhcCHHHHHHHHHHHhcCCCCCcCceecCCCCCccCCEE
Confidence            9999999999999999999999999999999999886    679999999999999999999999999888778779999


Q ss_pred             eCCCCEEEEeccccccCCcccCCCCCCccCCCCCCCCCCcccCCCcccccCCCCCCCCccHHHHHHHHHHHHHHHHhccE
Q 042798          159 INKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQ  238 (271)
Q Consensus       159 ip~g~~v~~~~~~~~~d~~~~g~~p~~f~p~R~l~~~~~~~~~~~~~~~~Fg~G~~~C~G~~~A~~e~~~~l~~ll~~f~  238 (271)
                      ||+|+.|+++.|++||||++||+||++|+|+||++.++.....+++.|+|||+|+|+|+|++||++|++++++.|+++|+
T Consensus       390 IpkGt~v~i~~~~ihrd~~~w~~dP~~F~PeRfl~~~~~~~~~~~~~~lPFG~GpR~CiG~~~A~~e~k~~la~ll~~f~  469 (500)
T PLN02169        390 VDAESKIVICIYALGRMRSVWGEDALDFKPERWISDNGGLRHEPSYKFMAFNSGPRTCLGKHLALLQMKIVALEIIKNYD  469 (500)
T ss_pred             ECCCCEEEEcHHHhhCCccccCCChhhcCccccCCCCCCccCCCCccccCCCCCCCCCcCHHHHHHHHHHHHHHHHHHCE
Confidence            99999999999999999999988999999999997544322224678999999999999999999999999999999999


Q ss_pred             EEeeCCCcccccccccccCCCCeeEEEEec
Q 042798          239 VKIVQGHPVSPCNSMVLHMKYGLKVQLSKR  268 (271)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R  268 (271)
                      ++++++.........+++|++++.+++++|
T Consensus       470 ~~~~~~~~~~~~~~~~l~~~~gl~l~l~~~  499 (500)
T PLN02169        470 FKVIEGHKIEAIPSILLRMKHGLKVTVTKK  499 (500)
T ss_pred             EEEcCCCCcccccceEEecCCCEEEEEEeC
Confidence            999866555445567789999999999987

>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-17
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-17
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 3e-17
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 7e-17
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 9e-15
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 1e-14
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 1e-14
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 1e-14
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 2e-14
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 3e-14
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 3e-14
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 3e-14
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 3e-14
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 3e-14
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 3e-14
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 3e-14
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 3e-14
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 3e-14
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 3e-14
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 4e-14
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 4e-14
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 5e-14
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 5e-14
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 6e-14
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 6e-14
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 7e-14
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 7e-14
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 8e-14
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 8e-14
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 8e-14
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-13
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-13
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 1e-13
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 1e-13
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 1e-13
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 1e-13
1fah_A471 Structure Of Cytochrome P450 Length = 471 1e-13
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 1e-13
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 1e-13
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-13
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 1e-13
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 2e-13
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 2e-13
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-13
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-13
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 2e-13
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 3e-13
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-13
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 5e-13
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 1e-12
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 6e-12
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 9e-12
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 2e-11
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-11
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 7e-11
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 1e-10
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 1e-10
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 1e-10
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 3e-10
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 3e-10
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 6e-10
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-09
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 1e-09
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-09
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 1e-09
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 1e-09
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 4e-09
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 5e-09
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-08
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 3e-08
3pm0_A507 Structural Characterization Of The Complex Between 3e-08
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-08
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 2e-07
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 3e-07
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 4e-07
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 4e-07
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 4e-07
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 9e-07
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 1e-06
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-06
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 5e-06
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 1e-05
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 1e-05
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 1e-05
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure 
Iteration: 1

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 94/193 (48%), Gaps = 28/193 (14%)
Query: 82  LLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANMVNR----------MVYLHAALC 131
            + AG ET SS L +  + +ATHP V+ K+ EE+ A + N+          M YL   + 
Sbjct: 280 FIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVN 339
Query: 132 ETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRW 191
           ETLRL+P +    +   + DV  +G  I K   ++I  YA+ R  + W +      P+++
Sbjct: 340 ETLRLFP-IAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTE------PEKF 392
Query: 192 ISERGSIVH---VPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHPVS 248
           + ER S  +   +  Y +T F +GPRNC+G   A + MK+    +L N+  K        
Sbjct: 393 LPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFK-------- 444
Query: 249 PCNSMVLHMKYGL 261
           PC    + +K  L
Sbjct: 445 PCKETQIPLKLSL 457
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-51
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-49
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 4e-49
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 4e-49
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 6e-49
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-48
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 7e-48
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-45
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 7e-44
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-43
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-41
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-36
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-36
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 5e-35
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-33
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-26
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-26
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 6e-26
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 9e-25
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-24
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-23
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-21
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 3e-21
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-20
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 7e-20
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-18
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 3e-18
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 4e-18
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 6e-18
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-07
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 2e-07
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 3e-07
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 6e-07
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 2e-06
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 2e-06
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 3e-06
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 3e-06
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 4e-06
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 6e-06
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 8e-06
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-05
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 2e-05
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 2e-05
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 2e-05
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 2e-05
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 2e-05
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 4e-05
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 5e-05
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 5e-05
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 6e-05
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 6e-05
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 8e-05
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 1e-04
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 1e-04
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 1e-04
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 1e-04
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 2e-04
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 2e-04
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 2e-04
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 3e-04
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 4e-04
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 5e-04
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 5e-04
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 6e-04
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 6e-04
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
 Score =  174 bits (443), Expect = 2e-51
 Identities = 64/278 (23%), Positives = 119/278 (42%), Gaps = 38/278 (13%)

Query: 7   KELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEGEEEEEMNEDREIG 66
           K+  K++K     +   I+ KR R+  S +   EE  D  T  ++  E+  ++       
Sbjct: 242 KKYEKSVKDLKDAIEVLIAEKRRRI--STEEKLEECMDFATE-LILAEKRGDLT------ 292

Query: 67  ALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANM------- 119
                   +      +L A  +T+S  L +  +L+A HP+VE  I++E++  +       
Sbjct: 293 -----RENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKI 347

Query: 120 --VNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYAMGRMEE 177
             + ++  +   + E++R  P V    + A + DV+  G+ + K  +I+++   M R+E 
Sbjct: 348 DDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVI-DGYPVKKGTNIILNIGRMHRLE- 405

Query: 178 IWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNY 237
            +     EF  + +          P   F  F  GPR C GK  A + MK +   +L  +
Sbjct: 406 FF-PKPNEFTLENFAKNV------PYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRF 458

Query: 238 QVKIVQGHPVSP---CNSMVLH---MKYGLKVQLSKRT 269
            VK +QG  V      + + LH    K  L++  + R 
Sbjct: 459 HVKTLQGQCVESIQKIHDLSLHPDETKNMLEMIFTPRN 496
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
Probab=100.00  E-value=4.3e-52  Score=378.83  Aligned_cols=246  Identities=21%  Similarity=0.392  Sum_probs=212.6

Q ss_pred             CCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCcchhhHHHHHHhcCchhhhhhhhhhhcccCCChHHHHHHHHH
Q 042798            2 HIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEGEEEEEMNEDREIGALRRNDTFLRDTAFN   81 (271)
Q Consensus         2 ~~~~~~~~~~a~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~   81 (271)
                      |++..++..++.+.+.+++.+.|++++..        ....+|+++.|++...++          +..++++++++++++
T Consensus       198 ~~~~~~~~~~~~~~l~~~~~~~i~~r~~~--------~~~~~d~l~~ll~~~~~~----------~~~ls~~ei~~~~~~  259 (461)
T 3ld6_A          198 PLPSFRRRDRAHREIKDIFYKAIQKRRQS--------QEKIDDILQTLLDATYKD----------GRPLTDDEVAGMLIG  259 (461)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHTTC--------CCCCCSHHHHHHTCBCTT----------SCBCCHHHHHHHHHH
T ss_pred             cCcHHHHHHHHHHHHHHHHHHHHHHHHhc--------CCCCcchhhhhHHhhhcc----------cCCCCHHHHHHHHHh
Confidence            45566778888999999999999887642        345679999999876532          235799999999999


Q ss_pred             HHhcCccchHHHHHHHHHHHhcChHHHHHHHHHHHHHh-----------hcCcHHHHHHHHhhccCCCCCCCcccccccc
Q 042798           82 LLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANM-----------VNRMVYLHAALCETLRLYPPVPYNHKIAAQA  150 (271)
Q Consensus        82 ~~~ag~~tt~~~l~~~l~~L~~~p~~~~~l~~Ei~~~~-----------~~~l~~l~~~i~E~lRl~~~~~~~~r~~~~~  150 (271)
                      +++||+|||+++++|++++|++||++|+++++|++++.           ++++||+++||+|++|++|+++...|++.. 
T Consensus       260 ~~~aG~dTt~~~l~~~l~~L~~~P~~q~kl~~Ei~~v~~~~~~~~~~~~l~~lpyl~avi~E~lRl~p~~~~~~r~~~~-  338 (461)
T 3ld6_A          260 LLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMART-  338 (461)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHCTTCCCCCHHHHHTCHHHHHHHHHHHHHSCSCCCEEEEESS-
T ss_pred             hhhcccccccccchhhhcccccChHHHHHHHHHHHHHhcccccchhHHHHHHHhhhhheeeeccccCCchhcccccccc-
Confidence            99999999999999999999999999999999999986           468999999999999999999988877766 


Q ss_pred             eeccCCeeeCCCCEEEEeccccccCCcccCCCCCCccCCCCCCCCCCcccCCCcccccCCCCCCCCccHHHHHHHHHHHH
Q 042798          151 DVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVA  230 (271)
Q Consensus       151 ~~~~~g~~ip~g~~v~~~~~~~~~d~~~~g~~p~~f~p~R~l~~~~~~~~~~~~~~~~Fg~G~~~C~G~~~A~~e~~~~l  230 (271)
                      |+.++||.||+|+.|+++.+.+||||++| +||++|+|+||++.++..  ..++.|+|||+|+|.|+|++||.+|+++++
T Consensus       339 d~~~~g~~ip~Gt~v~~~~~~~~~d~~~~-~dP~~F~PeRfl~~~~~~--~~~~~~~pFG~G~r~C~G~~lA~~e~~~~l  415 (461)
T 3ld6_A          339 PQTVAGYTIPPGHQVCVSPTVNQRLKDSW-VERLDFNPDRYLQDNPAS--GEKFAYVPFGAGRHRCIGENFAYVQIKTIW  415 (461)
T ss_dssp             CEEETTEEECTTCEEEECHHHHTTCTTTC-TTTTSCCGGGGGSCCHHH--HSSSSSCTTCCGGGCCSCHHHHHHHHHHHH
T ss_pred             ceeeCCcccCCCCeeeechHhhcCCcccc-CCccccCccccCCCCccc--CCCCccccCCCcCcCChhHHHHHHHHHHHH
Confidence            67789999999999999999999999999 899999999999865332  245679999999999999999999999999


Q ss_pred             HHHHhccEEEeeCCCcccccccccccCCCCeeEEEEecc
Q 042798          231 ALILGNYQVKIVQGHPVSPCNSMVLHMKYGLKVQLSKRT  269 (271)
Q Consensus       231 ~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R~  269 (271)
                      +.||++|+++++++..+......+..+..++.|++++|.
T Consensus       416 a~ll~~f~~~l~~~~~~~~~~~~~~~~p~~~~v~~~~Rs  454 (461)
T 3ld6_A          416 STMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRS  454 (461)
T ss_dssp             HHHHHHEEEECSTTCCCCBCCSSSSCCBSSCEEEEEECC
T ss_pred             HHHHHhCEEEeCCCCCCcccccceEEcCCceEEEEEECC
Confidence            999999999998876554444444455567899999996
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 271
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-30
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 4e-29
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 7e-26
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-24
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-19
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-15
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-14
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 7e-14
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 8e-14
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 3e-13
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 7e-11
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-10
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 7e-09
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 4e-08
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 8e-08
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-07
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 2e-07
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 4e-07
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 2e-06
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-06
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 3e-06
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  117 bits (292), Expect = 1e-30
 Identities = 50/280 (17%), Positives = 103/280 (36%), Gaps = 28/280 (10%)

Query: 2   HIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEGEEEEEMNE 61
             G  +++ + ++  + F+ + +  K    L         +  +L     + +   E + 
Sbjct: 200 FPGTHRQIYRNLQEINTFIGQSVE-KHRATLDPSNPRDFIDVYLLRMEKDKSDPSSEFHH 258

Query: 62  DREIGALRRNDTFLRDTAFNLLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKA---- 117
                        L  T  +L  AG ET S+ L + F L+  +P V  ++ +E++     
Sbjct: 259 QN-----------LILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEIEQVIGS 307

Query: 118 ------NMVNRMVYLHAALCETLRLYPPVPYNHKIAAQADVLPSGHRINKNHSILISYYA 171
                 +   +M Y  A + E  RL   +P+        D    G+ I KN  +     +
Sbjct: 308 HRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSS 367

Query: 172 MGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAA 231
                  + +    F P  ++   G++    +  F  F  G R CLG+  A  ++ +   
Sbjct: 368 ALHDPRYF-ETPNTFNPGHFLDANGALKR--NEGFMPFSLGKRICLGEGIARTELFLFFT 424

Query: 232 LILGNYQVKIVQGH---PVSPCNSMVLHMKYGLKVQLSKR 268
            IL N+ +          ++P  S V ++    +++   R
Sbjct: 425 TILQNFSIASPVPPEDIDLTPRESGVGNVPPSYQIRFLAR 464
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=1.8e-50  Score=363.50  Aligned_cols=251  Identities=21%  Similarity=0.323  Sum_probs=213.8

Q ss_pred             CCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCcchhhHHHHHHhcCchhhhhhhhhhhcccCCChHHHHHHHHH
Q 042798            2 HIGKEKELSKAMKTFDRFLYECISLKRERLLISRKASTEEEFDVLTAFMVEGEEEEEMNEDREIGALRRNDTFLRDTAFN   81 (271)
Q Consensus         2 ~~~~~~~~~~a~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~   81 (271)
                      |....+++.++++++.+++.+.|+++++....     .....|+++.|++...+.         +...+++++++++++.
T Consensus       183 ~~~~~~~~~~~~~~l~~~~~~~i~~~~~~~~~-----~~~~~dll~~ll~~~~~~---------~~~~ls~~ei~~~~~~  248 (445)
T d2ciba1         183 PIESFRRRDEARNGLVALVADIMNGRIANPPT-----DKSDRDMLDVLIAVKAET---------GTPRFSADEITGMFIS  248 (445)
T ss_dssp             SCHHHHHHHHHHHHHHHHHHHHHHHHHHCC----------CCCHHHHHHHCBCTT---------SSBSCCHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhhcccccc-----cccccchhhhhhcccccc---------ccccCCcchhhhhhhh
Confidence            45567788999999999999999988876543     244568999999875532         2346899999999999


Q ss_pred             HHhcCccchHHHHHHHHHHHhcChHHHHHHHHHHHHHh----------hcCcHHHHHHHHhhccCCCCCCCcccccccce
Q 042798           82 LLAAGKETVSSGLVWFFWLVATHPSVENKILEEMKANM----------VNRMVYLHAALCETLRLYPPVPYNHKIAAQAD  151 (271)
Q Consensus        82 ~~~ag~~tt~~~l~~~l~~L~~~p~~~~~l~~Ei~~~~----------~~~l~~l~~~i~E~lRl~~~~~~~~r~~~~~~  151 (271)
                      +++||++||+++++|++++|++||++|+++++|++++.          +.++|||+++|+|++|++|+++...|+++. +
T Consensus       249 ll~ag~~tt~~~l~~~l~~L~~~p~~~~~lr~Ei~~~~~~~~~~~~~~l~~lp~L~a~i~E~lRl~p~~~~~~~~~~~-~  327 (445)
T d2ciba1         249 MMFAGHHTSSGTASWTLIELMRHRDAYAAVIDELDELYGDGRSVSFHALRQIPQLENVLKETLRLHPPLIILMRVAKG-E  327 (445)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHGGGCCCHHHHTTSCCHHHHHHHHHHHHHSCSCCCEEEEECS-C
T ss_pred             hhhhccccchhhcccccccccccccccccccccccccccccccchhhhcccchhhccccccccccccccceecccccc-c
Confidence            99999999999999999999999999999999999875          678999999999999999999887777554 7


Q ss_pred             eccCCeeeCCCCEEEEeccccccCCcccCCCCCCccCCCCCCCCCCcccCCCcccccCCCCCCCCccHHHHHHHHHHHHH
Q 042798          152 VLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPQRWISERGSIVHVPSYKFTAFHAGPRNCLGKDTAFIQMKMVAA  231 (271)
Q Consensus       152 ~~~~g~~ip~g~~v~~~~~~~~~d~~~~g~~p~~f~p~R~l~~~~~~~~~~~~~~~~Fg~G~~~C~G~~~A~~e~~~~l~  231 (271)
                      +.++|+.||+|+.|+++.+.+|+||++| +||++|+|+||++.+.+. ...++.|+|||+|+|.|||++||..|++++++
T Consensus       328 ~~~~~~~ip~g~~v~~~~~~~~~d~~~~-~dp~~F~PeRf~~~~~~~-~~~~~~~~pFG~G~r~C~G~~~A~~~~~~~la  405 (445)
T d2ciba1         328 FEVQGHRIHEGDLVAASPAISNRIPEDF-PDPHDFVPARYEQPRQED-LLNRWTWIPFGAGRHRCVGAAFAIMQIKAIFS  405 (445)
T ss_dssp             EEETTEEECTTCEEEECHHHHTTCTTTS-SSTTSCCGGGGSTTTCHH-HHCTTTCCTTCCGGGCCTTHHHHHHHHHHHHH
T ss_pred             cccceeeccccccccccccccccCcccC-CChhhCCcccccCccccc-cCCCCcccCCCCCCccChhHHHHHHHHHHHHH
Confidence            8889999999999999999999999999 899999999999765322 23567899999999999999999999999999


Q ss_pred             HHHhccEEEeeCCCcc--cccccccccCCCCeeEEEEecc
Q 042798          232 LILGNYQVKIVQGHPV--SPCNSMVLHMKYGLKVQLSKRT  269 (271)
Q Consensus       232 ~ll~~f~~~~~~~~~~--~~~~~~~~~~~~~~~v~~~~R~  269 (271)
                      .||++|+++++++...  .....++..|+.++.|+++||.
T Consensus       406 ~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~Rs  445 (445)
T d2ciba1         406 VLLREYEFEMAQPPESYRNDHSKMVVQLAQPAAVRYRRRT  445 (445)
T ss_dssp             HHHHHEEEEESSCGGGCCEECSSSSCEECSCCEEEEEEC-
T ss_pred             HHHHhCEEEECCCCCccccccceEEEccCCCEEEEEEeCc
Confidence            9999999998865332  2234567788899999999995
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure