Citrus Sinensis ID: 042910

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MKFCKKYQEYMQGQERKLPGVGFKKLKKILKMCRKEFQSQKEINKGVVDTQTCPHQCPVCDGTFFPSLLNEMSAIVGCFNERAQKLLELHLASGFSKCLIWFKGKLHGTHGALIQEGKDLVTYALINAIAIRKILKKYDKVHYSKQGQAFKSQAQSMHVEILQSPWLCELMAFHINLRDTKVNTRKAPAFFEGCYLKFNDDKPSLSCELFDSVKLDIDLTCSICLVSQSFILFL
ccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccEEECcccccEEEEECcccEEEEcccccccccccccccccc
****KKYQEYMQGQERKLPGVGFKKLKKILKMCRKEF**************TCPHQCPVCDGTFFPSLLNEMSAIVGCFNERAQKLLELHLASGFSKCLIWFKGKLHGTHGALIQEGKDLVTYALINAIAIRKILKKYDKVHYSKQGQAFKSQAQSMHVEILQSPWLCELMAFHINLRDTKVNTRKAPAFFEGCYLKFNDDKPSLSCELFDSVKLDIDLTCSICLVSQSFILFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFCKKYQEYMQGQERKLPGVGFKKLKKILKMCRKEFQSQKEINKGVVDTQTCPHQCPVCDGTFFPSLLNEMSAIVGCFNERAQKLLELHLASGFSKCLIWFKGKLHGTHGALIQEGKDLVTYALINAIAIRKILKKYDKVHYSKQGQAFKSQAQSMHVEILQSPWLCELMAFHINLRDTKVNTRKAPAFFEGCYLKFNDDKPSLSCELFDSVKLDIDLTCSICLVSQSFILFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase BAH1 Mediates E2-dependent protein ubiquitination. Plays a role in salicylic acid-mediated negative feedback regulation of salicylic acid (SA) accumulation. May be involved in the overall regulation of SA, benzoic acid and phenylpropanoid biosynthesis. Controls the adaptability to nitrogen limitation by channeling the phenylpropanoid metabolic flux to the induced anthocyanin synthesis.probableQ9SRX9
Probable E3 ubiquitin-protein ligase BAH1-like 2 probableQ7XI73

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted