Citrus Sinensis ID: 042950
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 216 | ||||||
| 357484657 | 449 | Serine/threonine protein kinase ICK [Med | 0.976 | 0.469 | 0.425 | 4e-42 | |
| 255557681 | 455 | mak, putative [Ricinus communis] gi|2235 | 0.972 | 0.461 | 0.413 | 1e-40 | |
| 224074450 | 453 | predicted protein [Populus trichocarpa] | 0.972 | 0.463 | 0.428 | 5e-40 | |
| 356496445 | 450 | PREDICTED: cyclin-dependent kinase F-4-l | 0.986 | 0.473 | 0.407 | 3e-39 | |
| 356558874 | 450 | PREDICTED: cyclin-dependent kinase F-4-l | 0.902 | 0.433 | 0.420 | 6e-39 | |
| 449456767 | 449 | PREDICTED: cyclin-dependent kinase F-4-l | 0.962 | 0.463 | 0.400 | 3e-37 | |
| 356531493 | 455 | PREDICTED: cyclin-dependent kinase F-4-l | 0.981 | 0.465 | 0.392 | 6e-37 | |
| 224073080 | 437 | predicted protein [Populus trichocarpa] | 0.981 | 0.485 | 0.403 | 5e-35 | |
| 356559079 | 414 | PREDICTED: cyclin-dependent kinase F-4-l | 0.615 | 0.321 | 0.531 | 5e-35 | |
| 145333417 | 404 | putative serine/threonine protein kinase | 0.935 | 0.5 | 0.404 | 8e-35 |
| >gi|357484657|ref|XP_003612616.1| Serine/threonine protein kinase ICK [Medicago truncatula] gi|355513951|gb|AES95574.1| Serine/threonine protein kinase ICK [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Score = 176 bits (447), Expect = 4e-42, Method: Compositional matrix adjust.
Identities = 109/256 (42%), Positives = 140/256 (54%), Gaps = 45/256 (17%)
Query: 1 MAELLLFRPLFQGTDEAEQMYKICSVLGNPTMDSWADELRQA--------MLSGVNLSEL 52
MAEL RPLF G EA+++YKIC V+GNPT DSWAD L+ A L+GVNLS L
Sbjct: 189 MAELFSLRPLFPGASEADEIYKICGVIGNPTTDSWADGLKLARDINYQFPQLAGVNLSAL 248
Query: 53 MPSASKDAINLIESLCSWDPCKRPTAAEALQHLFFKRCLYAPPHIRSVPAVATT-----T 107
+PSAS AI+LI+SLCSWDPCKRPTA+EALQH FF+ C Y PP +RS AVA T T
Sbjct: 249 IPSASDHAISLIQSLCSWDPCKRPTASEALQHPFFQSCFYIPPSLRSR-AVARTPPPAGT 307
Query: 108 RGMLKQQGAGIEAEAL---------------PNPNIAKQLSPLDIIMVVQPKN--SVKKQ 150
RG L QQG AL P+ + ++L ++ + K+ + +
Sbjct: 308 RGALDQQGVKRYPGALHSSKPTNYFSSPKVQPSSGVQRKLDMVNQEGIKNEKSMKTTTQS 367
Query: 151 KY--------------YTASGRKGQHQNLANMAIAYNGRPVAQMKPPPMKAVVQWNDESR 196
KY T G + LANM+I + + Q +PPPMKA V W+ ES
Sbjct: 368 KYRHPGKESPTSVIKGRTIHGISETAERLANMSIGNRRQSMGQPRPPPMKAGVNWSSESP 427
Query: 197 EWFLRPIQNLEPGRIH 212
+ LRP + GR +
Sbjct: 428 NFMLRPAPQIPTGRTY 443
|
Source: Medicago truncatula Species: Medicago truncatula Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255557681|ref|XP_002519870.1| mak, putative [Ricinus communis] gi|223540916|gb|EEF42474.1| mak, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224074450|ref|XP_002304373.1| predicted protein [Populus trichocarpa] gi|222841805|gb|EEE79352.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356496445|ref|XP_003517078.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356558874|ref|XP_003547727.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449456767|ref|XP_004146120.1| PREDICTED: cyclin-dependent kinase F-4-like [Cucumis sativus] gi|449520459|ref|XP_004167251.1| PREDICTED: cyclin-dependent kinase F-4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356531493|ref|XP_003534312.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224073080|ref|XP_002303962.1| predicted protein [Populus trichocarpa] gi|222841394|gb|EEE78941.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356559079|ref|XP_003547829.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|145333417|ref|NP_001078408.1| putative serine/threonine protein kinase [Arabidopsis thaliana] gi|332658743|gb|AEE84143.1| putative serine/threonine protein kinase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 216 | ||||||
| TAIR|locus:2134746 | 464 | AT4G19110 [Arabidopsis thalian | 0.490 | 0.228 | 0.587 | 4e-37 | |
| TAIR|locus:2163583 | 499 | AT5G45430 [Arabidopsis thalian | 0.601 | 0.260 | 0.510 | 3.8e-35 | |
| UNIPROTKB|F1RV90 | 624 | MAK "Uncharacterized protein" | 0.805 | 0.278 | 0.331 | 2.3e-18 | |
| UNIPROTKB|Q8IXN4 | 457 | MAK "MAK protein" [Homo sapien | 0.652 | 0.308 | 0.346 | 4.8e-18 | |
| UNIPROTKB|P20794 | 623 | MAK "Serine/threonine-protein | 0.652 | 0.226 | 0.346 | 1e-17 | |
| RGD|3036 | 622 | Mak "male germ cell-associated | 0.606 | 0.210 | 0.368 | 1.3e-17 | |
| UNIPROTKB|P20793 | 622 | Mak "Serine/threonine-protein | 0.606 | 0.210 | 0.368 | 1.3e-17 | |
| UNIPROTKB|Q2YDJ7 | 382 | MAK "Uncharacterized protein" | 0.745 | 0.421 | 0.327 | 1.5e-17 | |
| MGI|MGI:96913 | 622 | Mak "male germ cell-associated | 0.606 | 0.210 | 0.368 | 1.7e-17 | |
| UNIPROTKB|E2RE89 | 589 | MAK "Uncharacterized protein" | 0.652 | 0.239 | 0.352 | 2.4e-17 |
| TAIR|locus:2134746 AT4G19110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 335 (123.0 bits), Expect = 4.0e-37, Sum P(2) = 4.0e-37
Identities = 67/114 (58%), Positives = 79/114 (69%)
Query: 1 MAELLLFRPLFQGTDEAEQMYKICSVLGNPTMDSWADELRQA--------MLSGVNLSEL 52
MAELL RP+F G EA+++YKICSV+G PT ++W + L A L GV LS L
Sbjct: 189 MAELLSLRPIFPGASEADEIYKICSVIGTPTEETWLEGLNLANTINYQFPQLPGVPLSSL 248
Query: 53 MPSASKDAINLIESLCSWDPCKRPTAAEALQHLFFKRCLYAPPHIRSVPAVATT 106
MPSAS+DAINLIE LCSWDP RPTAAE LQH FF+ C Y PP +R P+VA T
Sbjct: 249 MPSASEDAINLIERLCSWDPSSRPTAAEVLQHPFFQSCFYVPPSLRPKPSVART 302
|
|
| TAIR|locus:2163583 AT5G45430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RV90 MAK "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IXN4 MAK "MAK protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P20794 MAK "Serine/threonine-protein kinase MAK" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|3036 Mak "male germ cell-associated kinase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P20793 Mak "Serine/threonine-protein kinase MAK" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2YDJ7 MAK "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96913 Mak "male germ cell-associated kinase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RE89 MAK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_Genewise1_v1.C_LG_III1771 | hypothetical protein (453 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| fgenesh4_pg.C_scaffold_1033000001 | • | 0.407 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 216 | |||
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 8e-34 | |
| cd07841 | 298 | cd07841, STKc_CDK7, Catalytic domain of the Serine | 1e-21 | |
| cd07829 | 282 | cd07829, STKc_CDK_like, Catalytic domain of Cyclin | 2e-21 | |
| cd07834 | 330 | cd07834, STKc_MAPK, Catalytic domain of the Serine | 3e-21 | |
| cd05118 | 283 | cd05118, STKc_CMGC, Catalytic domain of CMGC famil | 2e-19 | |
| cd07852 | 337 | cd07852, STKc_MAPK15, Catalytic domain of the Seri | 9e-19 | |
| cd07840 | 287 | cd07840, STKc_CDK9_like, Catalytic domain of Cycli | 2e-18 | |
| cd07838 | 287 | cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc | 2e-16 | |
| PTZ00024 | 335 | PTZ00024, PTZ00024, cyclin-dependent protein kinas | 2e-15 | |
| cd07832 | 286 | cd07832, STKc_CCRK, Catalytic domain of the Serine | 2e-15 | |
| cd07842 | 316 | cd07842, STKc_CDK8_like, Catalytic domain of Cycli | 3e-15 | |
| cd07831 | 282 | cd07831, STKc_MOK, Catalytic domain of the Serine/ | 5e-15 | |
| cd07843 | 293 | cd07843, STKc_CDC2L1, Catalytic domain of the Seri | 1e-14 | |
| cd07849 | 336 | cd07849, STKc_ERK1_2_like, Catalytic domain of Ext | 7e-14 | |
| cd07851 | 343 | cd07851, STKc_p38, Catalytic domain of the Serine/ | 1e-13 | |
| cd07835 | 283 | cd07835, STKc_CDK1_like, Catalytic domain of Cycli | 4e-13 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 5e-13 | |
| cd07836 | 284 | cd07836, STKc_Pho85, Catalytic domain of the Serin | 7e-13 | |
| cd07857 | 332 | cd07857, STKc_MPK1, Catalytic domain of the Serine | 1e-12 | |
| cd07858 | 337 | cd07858, STKc_TEY_MAPK_plant, Catalytic domain of | 2e-12 | |
| cd07855 | 334 | cd07855, STKc_ERK5, Catalytic domain of the Serine | 2e-12 | |
| cd07861 | 285 | cd07861, STKc_CDK1_euk, Catalytic domain of the Se | 4e-12 | |
| cd07845 | 309 | cd07845, STKc_CDK10, Catalytic domain of the Serin | 5e-12 | |
| cd07866 | 311 | cd07866, STKc_BUR1, Catalytic domain of the Serine | 6e-12 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 6e-12 | |
| cd07880 | 343 | cd07880, STKc_p38gamma_MAPK12, Catalytic domain of | 6e-12 | |
| cd07856 | 328 | cd07856, STKc_Sty1_Hog1, Catalytic domain of the S | 7e-12 | |
| cd07859 | 338 | cd07859, STKc_TDY_MAPK_plant, Catalytic domain of | 1e-11 | |
| PLN00009 | 294 | PLN00009, PLN00009, cyclin-dependent kinase A; Pro | 6e-11 | |
| cd07837 | 295 | cd07837, STKc_CdkB_plant, Catalytic domain of the | 4e-10 | |
| cd07833 | 288 | cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep | 2e-09 | |
| cd07839 | 284 | cd07839, STKc_CDK5, Catalytic domain of the Serine | 2e-09 | |
| PTZ00036 | 440 | PTZ00036, PTZ00036, glycogen synthase kinase; Prov | 5e-09 | |
| cd07854 | 342 | cd07854, STKc_MAPK4_6, Catalytic domain of the Ser | 5e-09 | |
| cd07853 | 372 | cd07853, STKc_NLK, Catalytic domain of the Serine/ | 2e-08 | |
| cd07860 | 284 | cd07860, STKc_CDK2_3, Catalytic domain of the Seri | 2e-08 | |
| cd07879 | 342 | cd07879, STKc_p38delta_MAPK13, Catalytic domain of | 3e-08 | |
| cd07864 | 302 | cd07864, STKc_CDK12, Catalytic domain of the Serin | 1e-07 | |
| cd07865 | 310 | cd07865, STKc_CDK9, Catalytic domain of the Serine | 1e-07 | |
| cd07877 | 345 | cd07877, STKc_p38alpha_MAPK14, Catalytic domain of | 2e-07 | |
| cd07863 | 288 | cd07863, STKc_CDK4, Catalytic domain of the Serine | 2e-07 | |
| cd07846 | 286 | cd07846, STKc_CDKL2_3, Catalytic domain of the Ser | 4e-07 | |
| cd07873 | 301 | cd07873, STKc_PCTAIRE1, Catalytic domain of the Se | 8e-07 | |
| cd07844 | 291 | cd07844, STKc_PCTAIRE_like, Catalytic domain of PC | 3e-06 | |
| cd07871 | 288 | cd07871, STKc_PCTAIRE3, Catalytic domain of the Se | 4e-06 | |
| cd07878 | 343 | cd07878, STKc_p38beta_MAPK11, Catalytic domain of | 4e-06 | |
| cd07862 | 290 | cd07862, STKc_CDK6, Catalytic domain of the Serine | 5e-06 | |
| cd07872 | 309 | cd07872, STKc_PCTAIRE2, Catalytic domain of the Se | 9e-06 | |
| cd07850 | 353 | cd07850, STKc_JNK, Catalytic domain of the Serine/ | 3e-04 | |
| cd07876 | 359 | cd07876, STKc_JNK2, Catalytic domain of the Serine | 4e-04 | |
| cd07847 | 286 | cd07847, STKc_CDKL1_4, Catalytic domain of the Ser | 7e-04 | |
| cd08215 | 258 | cd08215, STKc_Nek, Catalytic domain of the Protein | 0.001 | |
| COG0515 | 384 | COG0515, SPS1, Serine/threonine protein kinase [Ge | 0.001 |
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
Score = 121 bits (307), Expect = 8e-34
Identities = 45/95 (47%), Positives = 63/95 (66%), Gaps = 8/95 (8%)
Query: 1 MAELLLFRPLFQGTDEAEQMYKICSVLGNPTMDSWAD--ELRQAM------LSGVNLSEL 52
MAEL RPLF G+ E +Q+YKICSVLG PT W + +L + + +L +L
Sbjct: 189 MAELYTLRPLFPGSSEIDQLYKICSVLGTPTKQDWPEGYKLASKLGFRFPQFAPTSLHQL 248
Query: 53 MPSASKDAINLIESLCSWDPCKRPTAAEALQHLFF 87
+P+AS +AI+LI+ + WDP KRPTA++ALQH +F
Sbjct: 249 IPNASPEAIDLIKDMLRWDPKKRPTASQALQHPYF 283
|
Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertility. It functions as a coactivator of the androgen receptor in prostate cells. MRK, also called Intestinal Cell Kinase (ICK), is expressed ubiquitously, with highest expression in the ovary and uterus. A missense mutation in MRK causes endocrine-cerebro-osteodysplasia (ECO), suggesting that this protein plays an important role in the development of many organs. MAK and MRK may be involved in regulating cell cycle and cell fate. Ime2p is a meiosis-specific kinase that is important during meiotic initiation and during the later stages of meiosis. Mde3 functions downstream of the transcription factor Mei-4 which is essential for meiotic prophase I. Length = 283 |
| >gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| KOG0660 | 359 | consensus Mitogen-activated protein kinase [Signal | 99.79 | |
| KOG0659 | 318 | consensus Cdk activating kinase (CAK)/RNA polymera | 99.77 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 99.77 | |
| KOG0661 | 538 | consensus MAPK related serine/threonine protein ki | 99.76 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 99.68 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 99.61 | |
| KOG0593 | 396 | consensus Predicted protein kinase KKIAMRE [Genera | 99.57 | |
| KOG0594 | 323 | consensus Protein kinase PCTAIRE and related kinas | 99.56 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 99.53 | |
| KOG0666 | 438 | consensus Cyclin C-dependent kinase CDK8 [Transcri | 99.48 | |
| KOG0662 | 292 | consensus Cyclin-dependent kinase CDK5 [Intracellu | 99.47 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 99.42 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 99.39 | |
| KOG0671 | 415 | consensus LAMMER dual specificity kinases [Signal | 99.35 | |
| KOG0669 | 376 | consensus Cyclin T-dependent kinase CDK9 [Cell cyc | 99.33 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 99.33 | |
| KOG0665 | 369 | consensus Jun-N-terminal kinase (JNK) [Signal tran | 99.32 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 99.29 | |
| KOG0668 | 338 | consensus Casein kinase II, alpha subunit [Signal | 99.25 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 99.25 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 99.23 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 99.23 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 99.22 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 99.21 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 99.21 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 99.21 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 99.2 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 99.2 | |
| KOG0033 | 355 | consensus Ca2+/calmodulin-dependent protein kinase | 99.17 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 99.17 | |
| PTZ00284 | 467 | protein kinase; Provisional | 99.17 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 99.14 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 99.13 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 99.12 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 99.11 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 99.11 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 99.11 | |
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 99.11 | |
| KOG0670 | 752 | consensus U4/U6-associated splicing factor PRP4 [R | 99.11 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 99.11 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 99.1 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 99.09 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 99.09 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 99.09 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 99.09 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 99.07 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 99.07 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 99.06 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 99.05 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 99.03 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 99.03 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 99.03 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 99.03 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 99.02 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 99.02 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 99.02 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 99.01 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 99.0 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 99.0 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 98.99 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 98.98 | |
| KOG1290 | 590 | consensus Serine/threonine protein kinase [Signal | 98.96 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 98.96 | |
| KOG0592 | 604 | consensus 3-phosphoinositide-dependent protein kin | 98.95 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 98.95 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 98.94 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 98.91 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 98.9 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 98.89 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 98.89 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 98.89 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 98.88 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 98.86 | |
| KOG0610 | 459 | consensus Putative serine/threonine protein kinase | 98.86 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 98.86 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 98.85 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 98.85 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 98.84 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 98.83 | |
| KOG0599 | 411 | consensus Phosphorylase kinase gamma subunit [Carb | 98.83 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 98.79 | |
| KOG0616 | 355 | consensus cAMP-dependent protein kinase catalytic | 98.78 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 98.78 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 98.75 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 98.75 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 98.74 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 98.72 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 98.71 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 98.69 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 98.68 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 98.67 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 98.67 | |
| KOG0598 | 357 | consensus Ribosomal protein S6 kinase and related | 98.66 | |
| KOG0588 | 786 | consensus Serine/threonine protein kinase [Cell cy | 98.66 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 98.65 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 98.64 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 98.61 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 98.61 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 98.6 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 98.6 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 98.6 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 98.6 | |
| KOG0604 | 400 | consensus MAP kinase-activated protein kinase 2 [S | 98.57 | |
| KOG0578 | 550 | consensus p21-activated serine/threonine protein k | 98.56 | |
| KOG0664 | 449 | consensus Nemo-like MAPK-related serine/threonine | 98.56 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 98.55 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 98.55 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 98.54 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 98.54 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 98.53 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 98.53 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 98.53 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 98.53 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 98.53 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 98.52 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 98.52 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 98.52 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 98.51 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 98.51 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 98.51 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 98.51 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 98.5 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 98.5 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 98.48 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 98.48 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 98.48 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 98.47 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 98.47 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 98.47 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 98.46 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 98.46 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 98.45 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 98.45 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 98.45 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 98.45 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 98.45 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 98.45 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 98.45 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 98.45 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 98.44 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 98.44 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 98.44 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 98.44 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 98.43 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 98.43 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 98.42 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 98.42 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 98.42 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 98.42 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 98.42 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 98.41 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 98.41 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 98.41 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 98.41 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 98.41 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 98.41 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 98.4 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 98.4 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 98.4 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 98.39 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 98.38 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 98.38 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 98.38 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 98.37 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 98.37 | |
| KOG0597 | 808 | consensus Serine-threonine protein kinase FUSED [G | 98.36 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 98.36 | |
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 98.36 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 98.35 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 98.35 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 98.35 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 98.35 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 98.34 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 98.34 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 98.33 | |
| KOG0583 | 370 | consensus Serine/threonine protein kinase [Signal | 98.33 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 98.32 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 98.32 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 98.32 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 98.32 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 98.32 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 98.31 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 98.3 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 98.3 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 98.3 | |
| KOG0607 | 463 | consensus MAP kinase-interacting kinase and relate | 98.29 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 98.29 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 98.29 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 98.28 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 98.28 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 98.27 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 98.27 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 98.26 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 98.26 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 98.26 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 98.26 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.25 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 98.24 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 98.23 | |
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 98.23 | |
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 98.23 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 98.22 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 98.21 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 98.21 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 98.2 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 98.2 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 98.2 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 98.19 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 98.19 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 98.18 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 98.18 | |
| KOG0596 | 677 | consensus Dual specificity; serine/threonine and t | 98.18 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 98.18 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 98.17 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 98.17 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 98.16 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 98.16 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 98.15 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 98.14 | |
| KOG4717 | 864 | consensus Serine/threonine protein kinase [Signal | 98.14 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 98.14 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 98.14 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 98.12 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 98.11 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 98.11 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 98.11 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 98.11 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 98.1 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 98.1 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 98.1 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 98.09 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 98.09 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 98.09 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 98.08 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 98.07 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 98.07 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 98.07 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 98.07 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 98.06 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 98.05 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 98.05 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 98.03 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 98.03 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 98.02 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 98.02 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 98.01 | |
| smart00750 | 176 | KIND kinase non-catalytic C-lobe domain. It is an | 97.99 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 97.99 | |
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 97.98 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 97.95 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 97.94 | |
| KOG0582 | 516 | consensus Ste20-like serine/threonine protein kina | 97.94 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 97.92 | |
| KOG0585 | 576 | consensus Ca2+/calmodulin-dependent protein kinase | 97.92 | |
| KOG0983 | 391 | consensus Mitogen-activated protein kinase (MAPK) | 97.87 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 97.86 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 97.85 | |
| KOG0608 | 1034 | consensus Warts/lats-like serine threonine kinases | 97.84 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 97.84 | |
| KOG0986 | 591 | consensus G protein-coupled receptor kinase [Signa | 97.82 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 97.71 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 97.69 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 97.68 | |
| KOG0589 | 426 | consensus Serine/threonine protein kinase [General | 97.55 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 97.54 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 97.52 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 97.5 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 97.49 | |
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 97.48 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 97.48 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 97.48 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 97.47 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 97.47 | |
| KOG4279 | 1226 | consensus Serine/threonine protein kinase [Signal | 97.44 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 97.43 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 97.43 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 97.43 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 97.43 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 97.42 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 97.42 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 97.39 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 97.37 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 97.37 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 97.36 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 97.35 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 97.33 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 97.32 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 97.32 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 97.3 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 97.3 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 97.3 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 97.29 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 97.29 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 97.29 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 97.28 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 97.28 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 97.27 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 97.25 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 97.24 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 97.23 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 97.23 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 97.23 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 97.22 | |
| KOG1027 | 903 | consensus Serine/threonine protein kinase and endo | 97.22 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 97.21 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 97.21 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 97.2 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 97.2 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 97.19 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 97.19 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 97.18 | |
| KOG0606 | 1205 | consensus Microtubule-associated serine/threonine | 97.15 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 97.15 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 97.13 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 97.12 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 97.12 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 97.11 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 97.1 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 97.1 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 97.1 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 97.1 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 97.07 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 97.06 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 97.06 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 97.06 | |
| KOG0695 | 593 | consensus Serine/threonine protein kinase [Signal | 97.04 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 97.02 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 96.99 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 96.97 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 96.94 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 96.94 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 96.93 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 96.93 | |
| KOG0584 | 632 | consensus Serine/threonine protein kinase [General | 96.92 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 96.91 | |
| KOG4645 | 1509 | consensus MAPKKK (MAP kinase kinase kinase) SSK2 a | 96.89 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 96.88 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 96.85 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 96.84 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 96.83 | |
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 96.82 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 96.81 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 96.77 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 96.75 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 96.74 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 96.71 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 96.7 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 96.69 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 96.69 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 96.69 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 96.56 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 96.5 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 96.43 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 96.43 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 96.43 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 96.4 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 96.35 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 96.34 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 96.34 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 96.26 | |
| KOG0590 | 601 | consensus Checkpoint kinase and related serine/thr | 96.21 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 96.18 | |
| KOG0611 | 668 | consensus Predicted serine/threonine protein kinas | 96.14 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 96.02 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 95.99 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 95.92 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 95.88 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 95.86 | |
| KOG0586 | 596 | consensus Serine/threonine protein kinase [General | 95.67 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 95.56 | |
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 95.41 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 95.32 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 95.2 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 95.04 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 94.68 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 94.66 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 94.62 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 94.62 | |
| KOG0587 | 953 | consensus Traf2- and Nck-interacting kinase and re | 93.85 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 93.81 | |
| KOG0606 | 1205 | consensus Microtubule-associated serine/threonine | 93.42 | |
| KOG0595 | 429 | consensus Serine/threonine-protein kinase involved | 93.1 | |
| KOG1151 | 775 | consensus Tousled-like protein kinase [Signal tran | 93.02 | |
| KOG2345 | 302 | consensus Serine/threonine protein kinase/TGF-beta | 92.89 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 92.24 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 91.9 | |
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 91.51 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 90.56 | |
| KOG1989 | 738 | consensus ARK protein kinase family [Signal transd | 90.32 | |
| KOG0576 | 829 | consensus Mitogen-activated protein kinase kinase | 86.85 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 86.09 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 82.99 |
| >KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.79 E-value=1.1e-19 Score=158.34 Aligned_cols=99 Identities=33% Similarity=0.501 Sum_probs=87.5
Q ss_pred CcccccCCCCCCCCCHHHHHHHHHHhhCCCCHHHHHHHH---------hhccccCCCccccCCCCCHHHHHHHHhccccC
Q 042950 1 MAELLLFRPLFQGTDEAEQMYKICSVLGNPTMDSWADEL---------RQAMLSGVNLSELMPSASKDAINLIESLCSWD 71 (216)
Q Consensus 1 L~ELltG~plF~g~s~~dql~~I~~ilG~p~~~~~~~~~---------~~~~~~~~~l~~~~~~~s~~~~dLL~~mL~~d 71 (216)
|+||++|+|||+|.+..+||..|++++|+|+++.+.... +++..++.++..+|++++++|+|||.+||++|
T Consensus 218 ~AEmL~gkplFpG~d~v~Ql~lI~~~lGtP~~e~l~~i~s~~ar~yi~slp~~p~~~f~~~fp~a~p~AidLlekmL~fd 297 (359)
T KOG0660|consen 218 LAEMLTGKPLFPGKDYVHQLQLILELLGTPSEEDLQKIRSEKARPYIKSLPQIPKQPFSSIFPNANPLAIDLLEKMLVFD 297 (359)
T ss_pred HHHHHcCCCCCCCCchHHHHHHHHHhcCCCCHHHHHHhccHHHHHHHHhCCCCCCCCHHHHcCCCCHHHHHHHHHHhccC
Confidence 579999999999999999999999999999998776543 45688899999999999999999999999999
Q ss_pred CCCCCCHHHHHcCccccCCCCCCCCCCCCc
Q 042950 72 PCKRPTAAEALQHLFFKRCLYAPPHIRSVP 101 (216)
Q Consensus 72 P~kR~ta~eaL~HpfF~~~~~~~~~~~~~~ 101 (216)
|.+|+||+|||+||||.. |..+...+.+
T Consensus 298 P~kRita~eAL~hPYl~~--~hdp~dEP~~ 325 (359)
T KOG0660|consen 298 PKKRITAEEALAHPYLAP--YHDPEDEPVC 325 (359)
T ss_pred ccccCCHHHHhcChhhhh--hcCCccCCCC
Confidence 999999999999999998 4544444433
|
|
| >KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] | Back alignment and domain information |
|---|
| >KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00750 KIND kinase non-catalytic C-lobe domain | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0589 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >KOG0584 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0586 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 216 | ||||
| 1ua2_A | 346 | Crystal Structure Of Human Cdk7 Length = 346 | 9e-09 | ||
| 2b9h_A | 353 | Crystal Structure Of Fus3 With A Docking Motif From | 3e-07 | ||
| 2b9f_A | 353 | Crystal Structure Of Non-Phosphorylated Fus3 Length | 3e-07 | ||
| 2f9g_A | 353 | Crystal Structure Of Fus3 Phosphorylated On Tyr182 | 3e-07 | ||
| 4exu_A | 371 | Mapk13, Inactive Form Length = 371 | 4e-07 | ||
| 3coi_A | 353 | Crystal Structure Of P38delta Kinase Length = 353 | 4e-07 | ||
| 4erw_A | 306 | Cdk2 In Complex With Staurosporine Length = 306 | 5e-07 | ||
| 1cm8_A | 367 | Phosphorylated Map Kinase P38-Gamma Length = 367 | 5e-07 | ||
| 1gz8_A | 299 | Human Cyclin Dependent Kinase 2 Complexed With The | 5e-07 | ||
| 2iw8_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 | 5e-07 | ||
| 4eos_A | 300 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 6e-07 | ||
| 1vyw_A | 309 | Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = | 6e-07 | ||
| 3pxf_A | 306 | Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N | 6e-07 | ||
| 1ogu_A | 302 | Structure Of Human Thr160-phospho Cdk2/cyclin A Com | 6e-07 | ||
| 1h1p_A | 303 | Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP | 6e-07 | ||
| 4eoq_A | 301 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 6e-07 | ||
| 4bcq_A | 301 | Structure Of Cdk2 In Complex With Cyclin A And A 2- | 6e-07 | ||
| 4eop_A | 300 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 6e-07 | ||
| 2iw6_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com | 6e-07 | ||
| 3ezr_A | 300 | Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ | 6e-07 | ||
| 4eoo_A | 299 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 7e-07 | ||
| 1w98_A | 298 | The Structural Basis Of Cdk2 Activation By Cyclin E | 7e-07 | ||
| 1pf8_A | 298 | Crystal Structure Of Human Cyclin-dependent Kinase | 7e-07 | ||
| 1gii_A | 298 | Human Cyclin Dependent Kinase 2 Complexed With The | 7e-07 | ||
| 3pj8_A | 299 | Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] | 7e-07 | ||
| 3bht_A | 300 | Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN | 7e-07 | ||
| 4eom_A | 301 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 7e-07 | ||
| 1jst_A | 298 | Phosphorylated Cyclin-Dependent Kinase-2 Bound To C | 7e-07 | ||
| 1oir_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 7e-07 | ||
| 1h01_A | 298 | Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili | 7e-07 | ||
| 4eoj_A | 302 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 7e-07 | ||
| 1oit_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 7e-07 | ||
| 2w17_A | 299 | Cdk2 In Complex With The Imidazole Pyrimidine Amide | 7e-07 | ||
| 1fin_A | 298 | Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = | 7e-07 | ||
| 3eb0_A | 383 | Crystal Structure Of Cgd4_240 From Cryptosporidium | 7e-07 | ||
| 1qmz_A | 299 | Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com | 7e-07 | ||
| 4eon_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 8e-07 | ||
| 4eok_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 8e-07 | ||
| 4eoi_A | 299 | Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc | 8e-07 | ||
| 3niz_A | 311 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 8e-07 | ||
| 2qkr_A | 313 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 8e-07 | ||
| 4e7w_A | 394 | Structure Of Gsk3 From Ustilago Maydis Length = 394 | 1e-06 | ||
| 1bmk_A | 379 | The Complex Structure Of The Map Kinase P38SB218655 | 2e-06 | ||
| 3tg1_A | 380 | Crystal Structure Of P38alpha In Complex With A Map | 2e-06 | ||
| 3py3_A | 380 | Crystal Structure Of Phosphorylated P38alpha Map Ki | 2e-06 | ||
| 2gtm_A | 348 | Mutated Mouse P38 Map Kinase Domain In Complex With | 2e-06 | ||
| 2puu_A | 348 | Crystal Structure Of P38 Complex With 1-(5-Tert-But | 2e-06 | ||
| 2ghl_A | 348 | Mutant Mus Musculus P38 Kinase Domain In Complex Wi | 2e-06 | ||
| 2oza_B | 366 | Structure Of P38alpha Complex Length = 366 | 2e-06 | ||
| 1lew_A | 360 | Crystal Structure Of Map Kinase P38 Complexed To Th | 2e-06 | ||
| 3p4k_A | 370 | The Third Conformation Of P38a Map Kinase Observed | 2e-06 | ||
| 1yw2_A | 360 | Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 | 2e-06 | ||
| 3e92_A | 371 | Crystal Structure Of P38 Kinase In Complex With A B | 3e-06 | ||
| 2y8o_A | 362 | Crystal Structure Of Human P38alpha Complexed With | 3e-06 | ||
| 3kq7_A | 380 | Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ | 3e-06 | ||
| 3dt1_A | 383 | P38 Complexed With A Quinazoline Inhibitor Length = | 3e-06 | ||
| 3d83_A | 360 | Crystal Structure Of P38 Kinase In Complex With A B | 3e-06 | ||
| 1bl6_A | 379 | The Complex Structure Of The Map Kinase P38SB216995 | 3e-06 | ||
| 4e5a_X | 360 | The W197a Mutant Of P38a Map Kinase Length = 360 | 3e-06 | ||
| 3gcp_A | 360 | Human P38 Map Kinase In Complex With Sb203580 Lengt | 3e-06 | ||
| 3nnx_A | 354 | Crystal Structure Of Phosphorylated P38 Alpha In Co | 3e-06 | ||
| 3mpt_A | 371 | Crystal Structure Of P38 Kinase In Complex With A P | 3e-06 | ||
| 3k3i_A | 350 | P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 | 3e-06 | ||
| 3hec_A | 348 | P38 In Complex With Imatinib Length = 348 | 3e-06 | ||
| 3s3i_A | 349 | P38 Kinase Crystal Structure In Complex With Small | 3e-06 | ||
| 3nnu_A | 354 | Crystal Structure Of P38 Alpha In Complex With Dp13 | 3e-06 | ||
| 3hvc_A | 362 | Crystal Structure Of Human P38alpha Map Kinase Leng | 3e-06 | ||
| 3qhr_A | 298 | Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic | 3e-06 | ||
| 2baq_A | 365 | P38alpha Bound To Ro3201195 Length = 365 | 3e-06 | ||
| 1ove_A | 366 | The Structure Of P38 Alpha In Complex With A Dihydr | 3e-06 | ||
| 3zsg_A | 362 | X-Ray Structure Of P38alpha Bound To Tak-715 Length | 3e-06 | ||
| 4i3z_A | 296 | Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES | 3e-06 | ||
| 1zzl_A | 351 | Crystal Structure Of P38 With Triazolopyridine Leng | 3e-06 | ||
| 2fst_X | 367 | Mitogen Activated Protein Kinase P38alpha (d176a+f3 | 3e-06 | ||
| 3d7z_A | 360 | Crystal Structure Of P38 Kinase In Complex With A B | 3e-06 | ||
| 2fsl_X | 367 | Mitogen Activated Protein Kinase P38alpha (D176a+f3 | 3e-06 | ||
| 1oz1_A | 372 | P38 Mitogen-Activated Kinase In Complex With 4-Azai | 3e-06 | ||
| 1ian_A | 366 | Human P38 Map Kinase Inhibitor Complex Length = 366 | 3e-06 | ||
| 1e9h_A | 297 | Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex | 3e-06 | ||
| 2gfs_A | 372 | P38 Kinase Crystal Structure In Complex With Ro3201 | 3e-06 | ||
| 2bal_A | 365 | P38alpha Map Kinase Bound To Pyrazoloamine Length = | 3e-06 | ||
| 3fi4_A | 372 | P38 Kinase Crystal Structure In Complex With Ro4499 | 3e-06 | ||
| 3o8p_A | 360 | Conformational Plasticity Of P38 Map Kinase Dfg Mot | 3e-06 | ||
| 2fso_X | 367 | Mitogen Activated Protein Kinase P38alpha (D176a) A | 3e-06 | ||
| 1m7q_A | 366 | Crystal Structure Of P38 Map Kinase In Complex With | 3e-06 | ||
| 3mh1_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 3e-06 | ||
| 4ewq_A | 383 | Human P38 Alpha Mapk In Complex With A Pyridazine B | 3e-06 | ||
| 3gcu_A | 360 | Human P38 Map Kinase In Complex With Rl48 Length = | 3e-06 | ||
| 3odz_X | 360 | Crystal Structure Of P38alpha Y323r Active Mutant L | 3e-06 | ||
| 3k3j_A | 362 | P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 | 3e-06 | ||
| 3mh2_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 3e-06 | ||
| 3mh3_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 3e-06 | ||
| 1ywr_A | 360 | Crystal Structure Analysis Of Inactive P38 Kinase D | 3e-06 | ||
| 3ody_X | 360 | Crystal Structure Of P38alpha Y323q Active Mutant L | 3e-06 | ||
| 3mh0_A | 360 | Mutagenesis Of P38 Map Kinase Eshtablishes Key Role | 3e-06 | ||
| 3gi3_A | 360 | Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana | 3e-06 | ||
| 2npq_A | 367 | A Novel Lipid Binding Site In The P38 Alpha Map Kin | 3e-06 | ||
| 2lgc_A | 359 | Joint Nmr And X-Ray Refinement Reveals The Structur | 3e-06 | ||
| 3od6_X | 360 | Crystal Structure Of P38alpha Y323t Active Mutant L | 3e-06 | ||
| 1di9_A | 360 | The Structure Of P38 Mitogen-Activated Protein Kina | 3e-06 | ||
| 2baj_A | 365 | P38alpha Bound To Pyrazolourea Length = 365 | 3e-06 | ||
| 3hrb_A | 359 | P38 Kinase Crystal Structure In Complex With Small | 3e-06 | ||
| 3oef_X | 360 | Crystal Structure Of Y323f Inactive Mutant Of P38al | 3e-06 | ||
| 1ob3_A | 288 | Structure Of P. Falciparum Pfpk5 Length = 288 | 4e-06 | ||
| 1v0o_A | 288 | Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho | 4e-06 | ||
| 1v0b_A | 288 | Crystal Structure Of The T198a Mutant Of Pfpk5 Leng | 4e-06 | ||
| 1ung_A | 292 | Structural Mechanism For The Inhibition Of Cdk5-P25 | 7e-06 | ||
| 1h4l_A | 292 | Structure And Regulation Of The Cdk5-P25(Nck5a) Com | 8e-06 | ||
| 2zoq_A | 382 | Structural Dissection Of Human Mitogen-Activated Ki | 1e-05 | ||
| 3oht_A | 389 | Crystal Structure Of Salmo Salar P38alpha Length = | 2e-05 | ||
| 4aaa_A | 331 | Crystal Structure Of The Human Cdkl2 Kinase Domain | 2e-05 | ||
| 3gc9_A | 370 | The Structure Of P38beta C119s, C162s In Complex Wi | 2e-05 | ||
| 2i6l_A | 320 | Crystal Structure Of Human Mitogen Activated Protei | 2e-05 | ||
| 3gc8_A | 370 | The Structure Of P38beta C162s In Complex With A Di | 2e-05 | ||
| 3n9x_A | 432 | Crystal Structure Of Map Kinase From Plasmodium Ber | 2e-05 | ||
| 3gp0_A | 348 | Crystal Structure Of Human Mitogen Activated Protei | 3e-05 | ||
| 2jgz_A | 289 | Crystal Structure Of Phospho-Cdk2 In Complex With C | 3e-05 | ||
| 1bi8_A | 326 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 3e-05 | ||
| 1jow_B | 308 | Crystal Structure Of A Complex Of Human Cdk6 And A | 4e-05 | ||
| 3sa0_A | 360 | Complex Of Erk2 With Norathyriol Length = 360 | 4e-05 | ||
| 4fv7_A | 360 | Crystal Structure Of The Erk2 Complexed With E94 Le | 4e-05 | ||
| 2w9f_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 4e-05 | ||
| 3nup_A | 307 | Cdk6 (Monomeric) In Complex With Inhibitor Length = | 4e-05 | ||
| 3g33_A | 308 | Crystal Structure Of Cdk4CYCLIN D3 Length = 308 | 4e-05 | ||
| 2w99_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 4e-05 | ||
| 2w96_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 5e-05 | ||
| 3rp9_A | 458 | Crystal Structure Of The Apo Mapk From Toxoplasma G | 5e-05 | ||
| 4acc_A | 465 | Gsk3b In Complex With Inhibitor Length = 465 | 6e-05 | ||
| 1q3d_A | 424 | Gsk-3 Beta Complexed With Staurosporine Length = 42 | 6e-05 | ||
| 3gb2_A | 353 | Gsk3beta Inhibitor Complex Length = 353 | 6e-05 | ||
| 1pyx_A | 422 | Gsk-3 Beta Complexed With Amp-Pnp Length = 422 | 6e-05 | ||
| 1gng_A | 378 | Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With | 6e-05 | ||
| 3zrk_A | 371 | Identification Of 2-(4-Pyridyl)thienopyridinones As | 6e-05 | ||
| 4afj_A | 367 | 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec | 7e-05 | ||
| 3say_A | 430 | Crystal Structure Of Human Glycogen Synthase Kinase | 7e-05 | ||
| 3f7z_A | 350 | X-ray Co-crystal Structure Of Glycogen Synthase Kin | 7e-05 | ||
| 3gbz_A | 329 | Structure Of The Cmgc Cdk Kinase From Giardia Lambl | 7e-05 | ||
| 2ow3_A | 352 | Glycogen Synthase Kinase-3 Beta In Complex With Bis | 7e-05 | ||
| 3zdi_A | 350 | Glycogen Synthase Kinase 3 Beta Complexed With Axin | 7e-05 | ||
| 2o5k_A | 372 | Crystal Structure Of Gsk3beta In Complex With A Ben | 7e-05 | ||
| 3sd0_A | 350 | Identification Of A Glycogen Synthase Kinase-3b Inh | 7e-05 | ||
| 3f88_A | 349 | Glycogen Synthase Kinase 3beta Inhibitor Complex Le | 7e-05 | ||
| 1pme_A | 380 | Structure Of Penta Mutant Human Erk2 Map Kinase Com | 7e-05 | ||
| 1uv5_A | 350 | Glycogen Synthase Kinase 3 Beta Complexed With 6-Br | 7e-05 | ||
| 1i09_A | 420 | Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len | 7e-05 | ||
| 3pg1_A | 362 | Map Kinase Lmampk10 From Leishmania Major (1.95 Ang | 7e-05 | ||
| 1r0e_A | 391 | Glycogen Synthase Kinase-3 Beta In Complex With 3-I | 7e-05 | ||
| 4dit_A | 382 | Crystal Structure Of Gsk3beta In Complex With A Imi | 7e-05 | ||
| 1q5k_A | 414 | Crystal Structure Of Glycogen Synthase Kinase 3 In | 8e-05 | ||
| 3uib_A | 362 | Map Kinase Lmampk10 From Leishmania Major In Comple | 8e-05 | ||
| 4gsb_A | 364 | Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 | 8e-05 | ||
| 4h3q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 8e-05 | ||
| 3mtl_A | 324 | Crystal Structure Of The Pctaire1 Kinase In Complex | 8e-05 | ||
| 3qyw_A | 364 | Crystal Structure Of Erk2 In Complex With An Inhibi | 8e-05 | ||
| 2ojg_A | 380 | Crystal Structure Of Erk2 In Complex With N,n-dimet | 8e-05 | ||
| 4fux_A | 360 | Crystal Structure Of The Erk2 Complexed With E75 Le | 8e-05 | ||
| 3zu7_A | 365 | Crystal Structure Of A Designed Selected Ankyrin Re | 9e-05 | ||
| 2z7l_A | 366 | Unphosphorylated Mitogen Activated Protein Kinase E | 9e-05 | ||
| 3c9w_A | 357 | Crystal Structure Of Erk-2 With Hypothemycin Covale | 9e-05 | ||
| 2fys_B | 364 | Crystal Structure Of Erk2 Complex With Kim Peptide | 9e-05 | ||
| 1gol_A | 364 | Coordinates Of Rat Map Kinase Erk2 With An Arginine | 9e-05 | ||
| 2y9q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 9e-05 | ||
| 3o71_A | 358 | Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length | 9e-05 | ||
| 4fv6_A | 360 | Crystal Structure Of The Erk2 Complexed With E57 Le | 9e-05 | ||
| 3zuv_A | 364 | Crystal Structure Of A Designed Selected Ankyrin Re | 9e-05 | ||
| 2erk_A | 365 | Phosphorylated Map Kinase Erk2 Length = 365 | 9e-05 | ||
| 2gph_A | 364 | Docking Motif Interactions In The Map Kinase Erk2 L | 1e-04 | ||
| 1wzy_A | 368 | Crystal Structure Of Human Erk2 Complexed With A Py | 1e-04 | ||
| 1tvo_A | 368 | The Structure Of Erk2 In Complex With A Small Molec | 1e-04 | ||
| 3tei_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 1e-04 | ||
| 3r63_A | 358 | Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | 2e-04 | ||
| 1h8f_A | 352 | Glycogen Synthase Kinase 3 Beta. Length = 352 | 2e-04 | ||
| 1o9u_A | 350 | Glycogen Synthase Kinase 3 Beta Complexed With Axin | 2e-04 | ||
| 2pvh_A | 352 | Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri | 4e-04 | ||
| 1na7_A | 329 | Crystal Structure Of The Catalytic Subunit Of Human | 4e-04 | ||
| 3bqc_A | 335 | High Ph-Value Crystal Structure Of Emodin In Comple | 5e-04 | ||
| 3nga_A | 333 | Human Ck2 Catalytic Domain In Complex With Cx-4945 | 5e-04 | ||
| 2zjw_A | 340 | Crystal Structure Of Human Ck2 Alpha Complexed With | 5e-04 | ||
| 1pjk_A | 334 | Crystal Structure Of A C-terminal Deletion Mutant O | 5e-04 | ||
| 3h30_A | 334 | Crystal Structure Of The Catalytic Subunit Of Human | 5e-04 | ||
| 3q04_A | 328 | Crystal Structure Of The Apo-Form Of Human Ck2 Alph | 5e-04 | ||
| 2r7i_A | 335 | Crystal Structure Of Catalytic Subunit Of Protein K | 5e-04 | ||
| 4dgl_C | 335 | Crystal Structure Of The Ck2 Tetrameric Holoenzyme | 5e-04 | ||
| 3mb6_A | 331 | Human Ck2 Catalytic Domain In Complex With A Difura | 5e-04 | ||
| 3juh_A | 335 | Crystal Structure Of A Mutant Of Human Protein Kina | 5e-04 | ||
| 3q9w_A | 336 | Crystal Structure Of Human Ck2 Alpha In Complex Wit | 5e-04 | ||
| 3nsz_A | 330 | Human Ck2 Catalytic Domain In Complex With Amppn Le | 5e-04 | ||
| 1jwh_A | 337 | Crystal Structure Of Human Protein Kinase Ck2 Holoe | 6e-04 | ||
| 3u87_A | 349 | Structure Of A Chimeric Construct Of Human Ck2alpha | 6e-04 | ||
| 3pvg_A | 331 | Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C | 7e-04 | ||
| 2qc6_A | 332 | Protein Kinase Ck2 In Complex With Dbc Length = 332 | 7e-04 | ||
| 3kxg_A | 327 | Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun | 8e-04 | ||
| 4dgm_A | 326 | Crystal Structure Of Maize Ck2 In Complex With The | 8e-04 | ||
| 4dgn_A | 326 | Crystal Structure Of Maize Ck2 In Complex With The | 8e-04 |
| >pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 | Back alignment and structure |
|
| >pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 | Back alignment and structure |
| >pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 | Back alignment and structure |
| >pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 | Back alignment and structure |
| >pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 | Back alignment and structure |
| >pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 | Back alignment and structure |
| >pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 | Back alignment and structure |
| >pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 | Back alignment and structure |
| >pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 | Back alignment and structure |
| >pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 | Back alignment and structure |
| >pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 | Back alignment and structure |
| >pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 | Back alignment and structure |
| >pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 | Back alignment and structure |
| >pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 | Back alignment and structure |
| >pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 | Back alignment and structure |
| >pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 | Back alignment and structure |
| >pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 | Back alignment and structure |
| >pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 | Back alignment and structure |
| >pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 | Back alignment and structure |
| >pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 | Back alignment and structure |
| >pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 | Back alignment and structure |
| >pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 | Back alignment and structure |
| >pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 | Back alignment and structure |
| >pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 | Back alignment and structure |
| >pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 | Back alignment and structure |
| >pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 | Back alignment and structure |
| >pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 | Back alignment and structure |
| >pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 | Back alignment and structure |
| >pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 | Back alignment and structure |
| >pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 | Back alignment and structure |
| >pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 | Back alignment and structure |
| >pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 | Back alignment and structure |
| >pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 | Back alignment and structure |
| >pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 | Back alignment and structure |
| >pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 | Back alignment and structure |
| >pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 | Back alignment and structure |
| >pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 | Back alignment and structure |
| >pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 | Back alignment and structure |
| >pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 | Back alignment and structure |
| >pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 | Back alignment and structure |
| >pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 | Back alignment and structure |
| >pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 | Back alignment and structure |
| >pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 | Back alignment and structure |
| >pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 | Back alignment and structure |
| >pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 | Back alignment and structure |
| >pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 | Back alignment and structure |
| >pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 | Back alignment and structure |
| >pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 | Back alignment and structure |
| >pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 | Back alignment and structure |
| >pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 | Back alignment and structure |
| >pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 | Back alignment and structure |
| >pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 | Back alignment and structure |
| >pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 | Back alignment and structure |
| >pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 | Back alignment and structure |
| >pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 | Back alignment and structure |
| >pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 | Back alignment and structure |
| >pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 | Back alignment and structure |
| >pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 | Back alignment and structure |
| >pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 | Back alignment and structure |
| >pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 | Back alignment and structure |
| >pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 | Back alignment and structure |
| >pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 | Back alignment and structure |
| >pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 | Back alignment and structure |
| >pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 | Back alignment and structure |
| >pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 | Back alignment and structure |
| >pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 | Back alignment and structure |
| >pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 | Back alignment and structure |
| >pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 | Back alignment and structure |
| >pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 | Back alignment and structure |
| >pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 | Back alignment and structure |
| >pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 | Back alignment and structure |
| >pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 | Back alignment and structure |
| >pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 | Back alignment and structure |
| >pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 | Back alignment and structure |
| >pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 | Back alignment and structure |
| >pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 | Back alignment and structure |
| >pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 | Back alignment and structure |
| >pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 | Back alignment and structure |
| >pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 | Back alignment and structure |
| >pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 | Back alignment and structure |
| >pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 | Back alignment and structure |
| >pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 | Back alignment and structure |
| >pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 | Back alignment and structure |
| >pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 | Back alignment and structure |
| >pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 | Back alignment and structure |
| >pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 | Back alignment and structure |
| >pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 | Back alignment and structure |
| >pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 | Back alignment and structure |
| >pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 | Back alignment and structure |
| >pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 | Back alignment and structure |
| >pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 | Back alignment and structure |
| >pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 | Back alignment and structure |
| >pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 | Back alignment and structure |
| >pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 | Back alignment and structure |
| >pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 | Back alignment and structure |
| >pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 | Back alignment and structure |
| >pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 | Back alignment and structure |
| >pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 | Back alignment and structure |
| >pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 | Back alignment and structure |
| >pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 | Back alignment and structure |
| >pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 | Back alignment and structure |
| >pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 | Back alignment and structure |
| >pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 | Back alignment and structure |
| >pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 | Back alignment and structure |
| >pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 | Back alignment and structure |
| >pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 | Back alignment and structure |
| >pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 | Back alignment and structure |
| >pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 | Back alignment and structure |
| >pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 | Back alignment and structure |
| >pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 | Back alignment and structure |
| >pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 | Back alignment and structure |
| >pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 | Back alignment and structure |
| >pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 | Back alignment and structure |
| >pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 | Back alignment and structure |
| >pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 | Back alignment and structure |
| >pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 | Back alignment and structure |
| >pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 | Back alignment and structure |
| >pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 | Back alignment and structure |
| >pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 | Back alignment and structure |
| >pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 | Back alignment and structure |
| >pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 | Back alignment and structure |
| >pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 | Back alignment and structure |
| >pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 | Back alignment and structure |
| >pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 | Back alignment and structure |
| >pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 | Back alignment and structure |
| >pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 | Back alignment and structure |
| >pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 | Back alignment and structure |
| >pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 | Back alignment and structure |
| >pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 | Back alignment and structure |
| >pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 | Back alignment and structure |
| >pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 | Back alignment and structure |
| >pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 | Back alignment and structure |
| >pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 | Back alignment and structure |
| >pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 | Back alignment and structure |
| >pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 | Back alignment and structure |
| >pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 | Back alignment and structure |
| >pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 | Back alignment and structure |
| >pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 | Back alignment and structure |
| >pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 | Back alignment and structure |
| >pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 | Back alignment and structure |
| >pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | Back alignment and structure |
| >pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 | Back alignment and structure |
| >pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 | Back alignment and structure |
| >pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 | Back alignment and structure |
| >pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 | Back alignment and structure |
| >pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 | Back alignment and structure |
| >pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 | Back alignment and structure |
| >pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 | Back alignment and structure |
| >pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 | Back alignment and structure |
| >pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 | Back alignment and structure |
| >pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 | Back alignment and structure |
| >pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 | Back alignment and structure |
| >pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 | Back alignment and structure |
| >pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 | Back alignment and structure |
| >pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 | Back alignment and structure |
| >pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 | Back alignment and structure |
| >pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 | Back alignment and structure |
| >pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 | Back alignment and structure |
| >pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 | Back alignment and structure |
| >pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 | Back alignment and structure |
| >pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 | Back alignment and structure |
| >pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 | Back alignment and structure |
| >pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 | Back alignment and structure |
| >pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 216 | |||
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 1e-24 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 1e-23 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 4e-23 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 9e-23 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 2e-22 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 3e-22 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 3e-22 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 4e-22 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 4e-22 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 5e-22 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 8e-22 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 5e-21 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 6e-21 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 2e-20 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 2e-20 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 2e-20 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 4e-20 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 5e-20 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 7e-20 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 2e-19 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 7e-19 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 1e-18 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 1e-18 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 3e-18 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 2e-17 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 9e-17 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 1e-16 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 3e-16 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 3e-16 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 4e-16 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 8e-16 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 6e-14 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 2e-13 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 1e-12 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 3e-11 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 5e-11 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 8e-09 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 4e-07 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 8e-07 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 2e-06 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 3e-06 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 6e-06 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 7e-06 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 8e-06 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 9e-06 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-05 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-05 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 2e-05 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 3e-05 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 3e-05 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 3e-05 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 3e-05 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 3e-05 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 5e-05 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 7e-05 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 7e-05 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 8e-05 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 8e-05 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 9e-05 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 1e-04 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 1e-04 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 1e-04 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 1e-04 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 1e-04 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 1e-04 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 1e-04 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 2e-04 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 2e-04 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 2e-04 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 2e-04 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 2e-04 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 2e-04 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 3e-04 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 3e-04 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 3e-04 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 3e-04 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 3e-04 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 3e-04 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 3e-04 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 4e-04 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 5e-04 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 5e-04 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 6e-04 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 7e-04 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 7e-04 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 7e-04 |
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
Score = 97.6 bits (244), Expect = 1e-24
Identities = 30/113 (26%), Positives = 44/113 (38%), Gaps = 11/113 (9%)
Query: 1 MAELLLFRPLFQGTDEAEQMYKICSVLGNPTMDSWADELRQAMLSGV---------NLSE 51
AELL PL+ G + +Q+Y I LG+ SGV L
Sbjct: 193 FAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLEL 252
Query: 52 LMPSASKDAINLIESLCSWDPCKRPTAAEALQHLFFK--RCLYAPPHIRSVPA 102
P+ S A+ L++ DP +R T + L H +F+ R + PA
Sbjct: 253 KFPNISYPALGLLKGCLHMDPTERLTCEQLLHHPYFENIREIEDLAKEHDKPA 305
|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.65 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 99.57 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 99.53 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.53 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 99.52 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 99.46 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 99.44 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.43 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 99.42 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 99.42 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 99.39 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.38 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 99.38 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 99.38 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 99.37 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 99.37 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 99.37 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 99.37 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 99.36 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 99.35 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.31 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 99.29 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 99.29 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 99.28 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 99.26 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 99.26 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 99.23 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.23 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 99.22 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 99.21 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 99.21 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.21 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 99.21 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.2 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.2 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 99.2 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.18 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 99.17 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.15 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 99.15 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 99.14 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 99.12 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 99.1 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.09 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 99.09 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.09 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 99.06 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 99.04 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 99.03 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.03 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.02 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 99.0 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 98.99 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 98.99 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 98.97 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 98.95 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 98.94 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 98.93 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 98.93 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 98.92 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 98.92 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 98.92 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 98.92 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 98.91 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 98.91 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 98.91 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 98.91 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 98.91 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 98.9 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 98.9 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.9 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 98.9 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 98.89 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 98.89 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 98.88 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 98.87 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 98.87 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 98.86 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 98.86 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 98.86 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 98.86 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 98.85 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 98.84 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 98.84 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 98.83 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 98.82 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 98.82 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 98.82 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 98.81 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 98.8 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 98.79 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 98.78 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 98.78 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 98.78 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 98.77 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 98.77 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 98.76 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 98.75 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 98.75 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 98.74 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 98.72 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 98.72 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 98.71 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 98.7 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 98.68 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 98.68 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 98.67 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 98.67 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 98.67 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 98.64 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 98.64 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 98.64 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 98.63 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 98.63 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 98.62 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 98.62 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 98.61 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 98.6 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 98.6 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 98.59 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 98.59 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 98.59 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 98.57 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 98.55 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 98.55 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 98.53 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 98.53 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 98.52 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 98.52 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 98.52 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 98.52 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 98.5 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 98.5 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 98.5 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 98.49 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 98.49 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 98.48 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 98.47 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 98.45 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 98.45 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 98.42 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 98.41 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 98.37 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 98.37 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 98.28 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 98.27 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 98.27 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 98.26 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 98.26 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 98.22 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 98.22 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 98.22 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 98.21 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 98.2 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 98.15 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 98.11 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 98.08 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 98.07 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 98.07 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 98.0 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 97.99 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 97.96 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 97.9 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 97.89 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 97.88 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 97.88 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 97.87 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 97.85 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 97.84 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 97.83 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 97.82 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 97.8 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 97.79 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 97.78 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 97.78 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 97.74 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 97.73 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 97.71 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 97.71 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 97.71 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 97.71 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 97.7 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 97.7 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 97.69 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 97.68 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 97.68 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 97.63 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 97.62 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 97.61 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 97.61 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 97.61 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 97.6 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 97.58 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 97.58 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 97.58 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 97.57 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 97.57 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 97.55 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 97.53 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 97.52 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 97.51 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 97.5 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 97.5 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 97.5 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 97.5 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 97.47 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 97.47 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 97.45 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 97.45 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 97.43 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 97.41 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 97.4 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 97.39 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 97.38 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 97.38 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 97.37 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 97.36 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 97.33 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 97.33 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 97.31 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 97.3 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 97.3 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 97.29 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 97.29 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 97.29 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 97.23 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 97.22 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 97.22 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 97.2 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 97.2 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 97.19 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 97.16 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 97.15 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 97.14 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 97.13 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 97.1 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 97.03 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 97.03 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 97.02 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 96.99 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 96.94 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 96.86 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 96.85 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 96.78 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 96.72 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 96.4 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 96.31 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 96.06 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 94.65 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 83.69 |
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.65 E-value=9.7e-17 Score=143.66 Aligned_cols=90 Identities=28% Similarity=0.418 Sum_probs=78.6
Q ss_pred CcccccCCCCCCCCCHHHHHHHHHHhhCCCCHHHHHHHH---------hhccccCCCccccCCCCCHHHHHHHHhccccC
Q 042950 1 MAELLLFRPLFQGTDEAEQMYKICSVLGNPTMDSWADEL---------RQAMLSGVNLSELMPSASKDAINLIESLCSWD 71 (216)
Q Consensus 1 L~ELltG~plF~g~s~~dql~~I~~ilG~p~~~~~~~~~---------~~~~~~~~~l~~~~~~~s~~~~dLL~~mL~~d 71 (216)
||||++|++||.|.++.+++..|++.+|.|+...|.... .++...+.+|..+++.++++++|||.+||++|
T Consensus 253 l~ell~G~~pF~g~~~~~~l~~I~~~~g~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~dLl~~mL~~d 332 (398)
T 4b99_A 253 FGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFE 332 (398)
T ss_dssp HHHHHHTSCSSCCSSHHHHHHHHHHHHCCCCGGGTC-----CHHHHHHSSCCCCCCCHHHHSTTCCHHHHHHHHHHSCSS
T ss_pred HHHHHHCCCCCCCCCHHHHHHHHHHhcCCCChHHhhhhhhhhhhhhhhcCCCcCCCCHHHhCCCCCHHHHHHHHHHCcCC
Confidence 589999999999999999999999999999987765332 23355667788889999999999999999999
Q ss_pred CCCCCCHHHHHcCccccCC
Q 042950 72 PCKRPTAAEALQHLFFKRC 90 (216)
Q Consensus 72 P~kR~ta~eaL~HpfF~~~ 90 (216)
|.+|+||.|||+||||++.
T Consensus 333 P~~R~ta~e~L~Hp~f~~~ 351 (398)
T 4b99_A 333 PSARISAAAALRHPFLAKY 351 (398)
T ss_dssp TTTSCCHHHHTTSGGGTTT
T ss_pred hhHCcCHHHHhcCHhhCcC
Confidence 9999999999999999974
|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 216 | ||||
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 9e-19 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 9e-19 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 2e-17 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 8e-17 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 2e-16 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 5e-16 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 1e-15 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 2e-15 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 5e-15 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 6e-15 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 5e-14 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 9e-14 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 9e-13 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 5e-12 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 8e-12 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 9e-12 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 2e-11 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 7e-11 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 2e-10 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 2e-10 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 3e-10 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 4e-09 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 5e-09 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 6e-09 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 7e-09 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 8e-09 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 1e-08 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 9e-08 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 1e-07 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 2e-07 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 3e-07 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 3e-07 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 9e-07 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 9e-07 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 9e-07 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 9e-07 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 1e-06 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 3e-06 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 4e-06 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 5e-06 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 6e-06 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 6e-06 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 6e-06 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 7e-06 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 1e-05 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 1e-05 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 2e-05 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 2e-05 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 2e-05 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 2e-05 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 4e-05 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 4e-05 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 4e-05 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 4e-05 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 5e-05 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 9e-05 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 1e-04 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 2e-04 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 3e-04 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 5e-04 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 8e-04 |
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Cell division protein kinase 7, CDK7 species: Human (Homo sapiens) [TaxId: 9606]
Score = 80.3 bits (197), Expect = 9e-19
Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 7/107 (6%)
Query: 1 MAELLLFRPLFQGTDEAEQMYKICSVLGNPTMDSWADELRQAM------LSGVNLSELMP 54
+AELLL P G + +Q+ +I LG PT + W D G+ L +
Sbjct: 191 LAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFS 250
Query: 55 SASKDAINLIESLCSWDPCKRPTAAEALQHLFFKRCLYAPPHIRSVP 101
+A D ++LI+ L ++PC R TA +AL+ +F P +P
Sbjct: 251 AAGDDLLDLIQGLFLFNPCARITATQALKMKYFSN-RPGPTPGCQLP 296
|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.63 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 99.6 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 99.59 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.56 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.54 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.5 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.48 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.47 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.44 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.36 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.36 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.34 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.23 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.22 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 99.21 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.21 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.2 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.18 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.16 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.15 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 99.13 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.12 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.12 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.1 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.07 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 99.07 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.07 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.06 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 99.04 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.03 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.02 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.0 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 98.99 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 98.96 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 98.9 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 98.87 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 98.52 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 98.33 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 98.28 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 98.28 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 98.27 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 98.23 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 98.22 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 98.18 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 98.17 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 98.17 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 98.07 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 98.03 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 98.02 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 98.0 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 97.98 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 97.96 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 97.95 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 97.88 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 97.83 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 97.82 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 97.72 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 97.6 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 97.49 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 96.81 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 96.26 |
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Cell division protein kinase 7, CDK7 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.63 E-value=6.8e-17 Score=136.29 Aligned_cols=92 Identities=33% Similarity=0.615 Sum_probs=79.4
Q ss_pred CcccccCCCCCCCCCHHHHHHHHHHhhCCCCHHHHHHHHhhc------cccCCCccccCCCCCHHHHHHHHhccccCCCC
Q 042950 1 MAELLLFRPLFQGTDEAEQMYKICSVLGNPTMDSWADELRQA------MLSGVNLSELMPSASKDAINLIESLCSWDPCK 74 (216)
Q Consensus 1 L~ELltG~plF~g~s~~dql~~I~~ilG~p~~~~~~~~~~~~------~~~~~~l~~~~~~~s~~~~dLL~~mL~~dP~k 74 (216)
||||++|+++|.+.++.+++.+|++.+|+|..+.|....... .....++..+++.++++++|||.+||++||++
T Consensus 191 l~el~~g~~pf~~~~~~~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~dll~~~L~~dP~~ 270 (299)
T d1ua2a_ 191 LAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCA 270 (299)
T ss_dssp HHHHHHSSCSSCCSSHHHHHHHHHHHHCCCCTTTSSSTTSSTTCCCCCCCCCCCHHHHCTTCCHHHHHHHHHHHCSSTTT
T ss_pred HHHHHhCcCCCCCCCHHHHHHHHHHhcCCCChhhccchhccchhhhhccCCCCChHHhcccCCHHHHHHHHHHccCChhh
Confidence 589999999999999999999999999999988886554443 33345566677789999999999999999999
Q ss_pred CCCHHHHHcCccccCCCC
Q 042950 75 RPTAAEALQHLFFKRCLY 92 (216)
Q Consensus 75 R~ta~eaL~HpfF~~~~~ 92 (216)
|+||.|||+||||++.+.
T Consensus 271 R~sa~e~L~Hp~f~~~p~ 288 (299)
T d1ua2a_ 271 RITATQALKMKYFSNRPG 288 (299)
T ss_dssp SCCHHHHHTSGGGTSSSC
T ss_pred CcCHHHHhCCHhhCCCCC
Confidence 999999999999998544
|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|