Query         042956
Match_columns 103
No_of_seqs    132 out of 1017
Neff          7.6 
Searched_HMMs 46136
Date          Fri Mar 29 11:19:03 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042956.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042956hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04660 nsLTP_like nsLTP_like:  99.7 2.1E-18 4.5E-23  103.9   4.7   71   31-103     1-73  (73)
  2 cd01960 nsLTP1 nsLTP1: Non-spe  99.7 1.3E-18 2.7E-23  108.2   3.6   72   30-102     2-81  (89)
  3 PF14368 LTP_2:  Probable lipid  99.7 2.6E-18 5.6E-23  107.2   1.4   77   25-103    16-96  (96)
  4 cd01959 nsLTP2 nsLTP2: Non-spe  99.6 2.3E-16 4.9E-21   93.4   4.4   64   35-103     3-66  (66)
  5 cd00010 AAI_LTSS AAI_LTSS: Alp  99.6 8.1E-16 1.8E-20   89.6   3.8   59   38-97      1-63  (63)
  6 smart00499 AAI Plant lipid tra  99.3 1.4E-12 3.1E-17   77.5   4.4   73   31-103     1-79  (79)
  7 PF00234 Tryp_alpha_amyl:  Prot  99.1 1.8E-12 3.9E-17   80.1  -3.3   68   35-103    12-90  (90)
  8 PF07172 GRP:  Glycine rich pro  93.9   0.052 1.1E-06   34.1   2.3   22    1-22      1-22  (95)
  9 PF14547 Hydrophob_seed:  Hydro  93.7   0.034 7.4E-07   34.3   1.2   72   31-103     2-84  (85)
 10 cd01958 HPS_like HPS_like: Hyd  92.6    0.23   5E-06   30.7   3.7   73   30-103     3-85  (85)
 11 cd00261 AAI_SS AAI_SS: Alpha-A  89.8    0.11 2.4E-06   32.8   0.3   68   36-103    13-108 (110)
 12 PF05617 Prolamin_like:  Prolam  45.4      11 0.00024   21.6   0.8   21   51-71     26-46  (70)
 13 TIGR01165 cbiN cobalt transpor  40.8      32  0.0007   21.5   2.4   15    1-15      1-15  (91)
 14 PF15284 PAGK:  Phage-encoded v  36.6      23 0.00051   20.4   1.3   21    1-21      1-21  (61)
 15 PF10731 Anophelin:  Thrombin i  35.5      75  0.0016   18.4   3.2   18    1-18      1-18  (65)
 16 PF15240 Pro-rich:  Proline-ric  34.6      32  0.0007   24.1   1.9    8    9-16      3-10  (179)
 17 CHL00132 psaF photosystem I su  33.6      49  0.0011   23.2   2.7   34    5-44      2-35  (185)
 18 PRK12750 cpxP periplasmic repr  33.3      52  0.0011   22.6   2.8   20    1-20      1-20  (170)
 19 PF10868 DUF2667:  Protein of u  29.1      27 0.00058   21.8   0.7    6    1-6       1-6   (90)
 20 PF06411 HdeA:  HdeA/HdeB famil  29.1      26 0.00057   21.4   0.7   13   35-47     30-42  (94)
 21 PLN00019 photosystem I reactio  26.3      87  0.0019   22.7   3.0   10   35-44     66-75  (223)
 22 PF05294 Toxin_5:  Scorpion sho  24.0      23 0.00049   17.8  -0.2   16   55-70     16-32  (32)
 23 PLN00214 putative protein; Pro  23.6      65  0.0014   20.9   1.8   24   51-74     59-82  (115)
 24 PRK00059 prsA peptidylprolyl i  22.5      91   0.002   23.1   2.7   18    1-18      1-18  (336)
 25 PRK07021 fliL flagellar basal   20.4      80  0.0017   21.2   1.9   13    4-16     15-27  (162)

No 1  
>cd04660 nsLTP_like nsLTP_like: Non-specific lipid-transfer protein (nsLTP)-like subfamily; composed of predominantly uncharacterized proteins with similarity to nsLTPs, including Medicago truncatula MtN5, the root-specific Phaseolus vulgaris PVR3, Antirrhinum majus FIL1, and Lilium longiflorum LIM3. Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes. The MtN5 gene is induced during root nodule development. FIL1 is thought to be important in petal and stamen formation. The LIM3 gene is induced during the early prophase stage of meiosis in lily microsporocytes.
Probab=99.74  E-value=2.1e-18  Score=103.89  Aligned_cols=71  Identities=51%  Similarity=0.914  Sum_probs=60.0

Q ss_pred             CccccccccCcHHHhhcCCC-CCCChhHHHhhhcCCcccccccccccccccCCCCHHHHhhhhhhcCCCCC-CCC
Q 042956           31 CRMTKDGLTACQPAVAASNP-SPPSTACCSALSKADLQCFCVFKNSRVLSFYGIDFHQAMQLPAKCNLGDS-FHC  103 (103)
Q Consensus        31 C~~~~~~l~~C~~yl~~~~~-~~Ps~~CC~~l~~~~~~ClC~~l~~~~~~~~~i~~~~a~~Lp~~Cg~~~p-~~c  103 (103)
                      |+.++..|.+|++|++++++ ..||++||+++|+.+++|+|.+++....  ..||.+||.+||++||+++| ++|
T Consensus         1 C~~~~~~L~~C~~yl~~~~~~~~Ps~~CC~~vk~~~~~C~C~~~~~~~~--~~i~~~~a~~Lp~~Cgv~~p~~~C   73 (73)
T cd04660           1 CNMDLDLLAECQPYVTGPNPPPPPSRECCAALRRADLPCLCRYKTSLVL--QIIDPDKAVYLPAKCGLPLPPSSC   73 (73)
T ss_pred             CCCCHHHHHHHHHHHcCCCCCCCCCHHHHHHHHcCCcCCEeeccCCCcc--cccCHHHHHHHHHHcCCCCCCCCC
Confidence            66677789999999997653 4699999999999999999999986433  35999999999999999987 455


No 2  
>cd01960 nsLTP1 nsLTP1: Non-specific lipid-transfer protein type 1 (nsLTP1) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes. In addition to lipid transport and assembly, nsLTPs also play a key role in the defense of plants against pathogens. There are two closely-related types of nsLTPs, types 1 and 2, which differ in protein sequence, molecular weight, and biological properties. nsLTPs contain an internal hydrophobic cavity, which serves as the binding site for lipids. The hydrophobic cavity accommodates various fatty acid ligands containing from ten to 18 carbon atoms. In general, the cavity is larger in nsLTP1 than in nsLTP2. nsLTP1 proteins are located in extracellular layers and in vacuolar structures. They may be involved in the formation of cutin layers on plant surfaces by transporting cutin monomers. Many nsLTP1 proteins have been characterized as allergens in humans.
Probab=99.74  E-value=1.3e-18  Score=108.22  Aligned_cols=72  Identities=28%  Similarity=0.513  Sum_probs=63.0

Q ss_pred             CCccccccccCcHHHhhcCCCCCCChhHHHhhhc--------CCcccccccccccccccCCCCHHHHhhhhhhcCCCCCC
Q 042956           30 LCRMTKDGLTACQPAVAASNPSPPSTACCSALSK--------ADLQCFCVFKNSRVLSFYGIDFHQAMQLPAKCNLGDSF  101 (103)
Q Consensus        30 ~C~~~~~~l~~C~~yl~~~~~~~Ps~~CC~~l~~--------~~~~ClC~~l~~~~~~~~~i~~~~a~~Lp~~Cg~~~p~  101 (103)
                      +|.++...|.||++|++|++ ..|+++||+++++        .|++|+|+++++....+.+||.+|+.+||++||+++||
T Consensus         2 ~C~~v~~~l~~C~~y~~g~~-~~Ps~~CC~~v~~l~~~~~t~~~~~~~C~C~~~~~~~~~~i~~~~a~~LP~~C~v~~~~   80 (89)
T cd01960           2 SCGQVTSLLAPCLGYLTGGG-PAPSPACCSGVKSLNGLAKTTADRQAACNCLKSAAAGISGLNPGRAAGLPGKCGVSIPY   80 (89)
T ss_pred             CHHHHHhhHHhHHHHHhCCC-CCCChHHhhhhHHHhhccCCCCchhhhhhcccccccccCCCCHHHHHhChHhcccCCCC
Confidence            68888889999999999876 5899999999997        36789999999866655569999999999999999876


Q ss_pred             C
Q 042956          102 H  102 (103)
Q Consensus       102 ~  102 (103)
                      +
T Consensus        81 ~   81 (89)
T cd01960          81 P   81 (89)
T ss_pred             C
Confidence            4


No 3  
>PF14368 LTP_2:  Probable lipid transfer; PDB: 2RKN_A 1N89_A 1TUK_A.
Probab=99.71  E-value=2.6e-18  Score=107.23  Aligned_cols=77  Identities=32%  Similarity=0.544  Sum_probs=49.4

Q ss_pred             CCCCCCCccccccccCcHHHhhcCCCCCCChhHHHhhhc---CCcccccccccccccccCCCCHHHHhhhhhhcCCCCCC
Q 042956           25 VNGDGLCRMTKDGLTACQPAVAASNPSPPSTACCSALSK---ADLQCFCVFKNSRVLSFYGIDFHQAMQLPAKCNLGDSF  101 (103)
Q Consensus        25 ~~~~~~C~~~~~~l~~C~~yl~~~~~~~Ps~~CC~~l~~---~~~~ClC~~l~~~~~~~~~i~~~~a~~Lp~~Cg~~~p~  101 (103)
                      +....+|.+++....+|..|++++  ..||++||+++++   .+++|||+++++.....++||.+|+..||++||++.|+
T Consensus        16 ~~~~~~c~~~l~~c~~~~~~~~~~--~~Ps~~CC~~l~~~~~~~~~ClC~~~~~~~~~~~~in~~~a~~Lp~~Cg~~~~~   93 (96)
T PF14368_consen   16 AACCCSCANSLLPCCPCLCYVTGG--PAPSAACCSALKSVVQADPPCLCQLLNSPGAPGFGINVTRALALPAACGVPVPP   93 (96)
T ss_dssp             --BTTB-HCCCCHH--HHHHHCC-------HHHHHHHCC----HCCHHHCCCC-CCHCHHCCTCHHHHHHHHHCTSS-S-
T ss_pred             CCCcchhHHHHhccccchhccCCC--CCCCHHHHHHHHHhccCCCCCHHHhcCccccccCCcCHHHHHHHHHHcCCCCCC
Confidence            345567744333333447888743  5899999999999   59999999999876344689999999999999999875


Q ss_pred             -CC
Q 042956          102 -HC  103 (103)
Q Consensus       102 -~c  103 (103)
                       .|
T Consensus        94 ~~C   96 (96)
T PF14368_consen   94 SKC   96 (96)
T ss_dssp             ---
T ss_pred             CCC
Confidence             55


No 4  
>cd01959 nsLTP2 nsLTP2: Non-specific lipid-transfer protein type 2 (nsLTP2) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes. In addition to lipid transport and assembly, nsLTPs also play a key role in the defense of plants against pathogens. There are two closely-related types of nsLTPs, types 1 and 2, which differ in protein sequence, molecular weight, and biological properties. nsLTPs contain an internal hydrophobic cavity, which serves as the binding site for lipids. nsLTP2 can bind lipids and sterols. Structure studies of rice nsLTPs show that the plasticity of the hydrophobic cavity is an important factor in ligand binding. The flexibility of the sLTP2 cavity allows its binding to rigid sterol molecules, whereas nsLTP1 cannot bind sterols despite its larger cavity size. The resulting nsLTP2/sterol complexes may bind to receptors that trigger defense responses. nsLTP2 gene exp
Probab=99.64  E-value=2.3e-16  Score=93.41  Aligned_cols=64  Identities=31%  Similarity=0.755  Sum_probs=55.1

Q ss_pred             cccccCcHHHhhcCCCCCCChhHHHhhhcCCcccccccccccccccCCCCHHHHhhhhhhcCCCCCCCC
Q 042956           35 KDGLTACQPAVAASNPSPPSTACCSALSKADLQCFCVFKNSRVLSFYGIDFHQAMQLPAKCNLGDSFHC  103 (103)
Q Consensus        35 ~~~l~~C~~yl~~~~~~~Ps~~CC~~l~~~~~~ClC~~l~~~~~~~~~i~~~~a~~Lp~~Cg~~~p~~c  103 (103)
                      ..+|.+|++|++++  .+||++||+.+|+.+ .|||++++++....+ ||.++|.+||++||+++| +|
T Consensus         3 ~~~L~~C~~ai~~~--~~Ps~~CC~~Lk~~~-~CLC~y~~~p~l~~~-i~~~~A~~l~~~Cgv~~P-~C   66 (66)
T cd01959           3 PTQLSPCLPAILGG--SPPSAACCAKLKEQQ-SCLCQYAKNPSLKQY-VNSPNARKVLAACGVPYP-NC   66 (66)
T ss_pred             hhhcccCHHHHhCC--CCCCHHHHHHHhcCC-CCeeeeecCccHHhh-cCcHHHHHHHHHcCCCCC-CC
Confidence            35899999999975  579999999999976 899999998765544 899999999999999986 44


No 5  
>cd00010 AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), Lipid Transfer (LT) and Seed Storage (SS) Protein family; a protein family unique to higher plants that includes cereal-type alpha-amylase inhibitors, lipid transfer proteins, seed storage proteins, and similar proteins. Proteins in this family are known to play important roles, in defending plants from insects and pathogens, lipid transport between intracellular membranes, and nutrient storage. Many proteins of this family have been identified as allergens in humans. These proteins contain a common pattern of eight cysteines that form four disulfide bridges.
Probab=99.60  E-value=8.1e-16  Score=89.63  Aligned_cols=59  Identities=32%  Similarity=0.738  Sum_probs=51.3

Q ss_pred             ccCcHHHhhcCCCCCCChhHHHhhhc---CCcccccccccccccccCCC-CHHHHhhhhhhcCC
Q 042956           38 LTACQPAVAASNPSPPSTACCSALSK---ADLQCFCVFKNSRVLSFYGI-DFHQAMQLPAKCNL   97 (103)
Q Consensus        38 l~~C~~yl~~~~~~~Ps~~CC~~l~~---~~~~ClC~~l~~~~~~~~~i-~~~~a~~Lp~~Cg~   97 (103)
                      |.||++|+++++ ..||++||+++++   .++.|+|+++++.....+++ |.+++.+||++||+
T Consensus         1 L~~C~~y~~~~~-~~Ps~~CC~~l~~~~~~~~~ClC~~~~~~~~~~~~~~~~~~a~~LP~~Cgv   63 (63)
T cd00010           1 LAPCLSYLTGGA-TAPPSDCCSGLKSVVKSDPKCLCAALNGPGASLLGLKNATRALALPAACGL   63 (63)
T ss_pred             CcchHHHHcCCC-CCCChHHHHHHHHHHhcChhhHHHHHcCccccccCcccHHHHHhchHhcCC
Confidence            579999999865 5899999999998   47899999999976665566 79999999999996


No 6  
>smart00499 AAI Plant lipid transfer protein / seed storage protein / trypsin-alpha amylase inhibitor domain family.
Probab=99.34  E-value=1.4e-12  Score=77.49  Aligned_cols=73  Identities=27%  Similarity=0.600  Sum_probs=59.8

Q ss_pred             CccccccccCcHHHhhcCC-CCCCChhHHHhhhcC-CcccccccccccccccCC---CCHHHHhhhhhhcCCCCC-CCC
Q 042956           31 CRMTKDGLTACQPAVAASN-PSPPSTACCSALSKA-DLQCFCVFKNSRVLSFYG---IDFHQAMQLPAKCNLGDS-FHC  103 (103)
Q Consensus        31 C~~~~~~l~~C~~yl~~~~-~~~Ps~~CC~~l~~~-~~~ClC~~l~~~~~~~~~---i~~~~a~~Lp~~Cg~~~p-~~c  103 (103)
                      |......+.+|.+|+++.. ...|+.+||++++.. +..|+|..++........   ++..++..||+.||+..+ +.|
T Consensus         1 C~~~~~~~~~c~~~~~~~~~~~~p~~~CC~~l~~~~~~~C~C~~~~~~~~~~~~~~~~~~~~a~~lp~~C~~~~~~~~C   79 (79)
T smart00499        1 CGQVLLQLAPCLSYLTGGSPGAPPSQQCCSQLRGLNSAQCRCLALRAAVLGILEIPGVNAQNAASLPSACGVPPPYTDC   79 (79)
T ss_pred             ChhhhhhHHhhHHHHcCCCCCCCCchHHHHHHHHhcccCCcchhhhcccccccchhhhhHHHHHhhHHhcCCCCCCCCC
Confidence            4555667779999998763 357999999999998 999999999976554433   599999999999999987 555


No 7  
>PF00234 Tryp_alpha_amyl:  Protease inhibitor/seed storage/LTP family This is a small subfamily;  InterPro: IPR003612 This domain is found is several proteins, including plant lipid transfer proteins [], seed storage proteins [] and trypsin-alpha amylase inhibitors [, ]. The domain forms a four-helical bundle in a right-handed superhelix with a folded leaf topology, which is stabilised by disulphide bonds, and which has an internal cavity. More information about this protein can be found at Protein of the Month: alpha-Amylase [].; PDB: 1BFA_A 1BEA_A 1MID_A 1BE2_A 1LIP_A 3GSH_A 1JTB_A 1UVC_B 1BV2_A 1UVB_A ....
Probab=99.12  E-value=1.8e-12  Score=80.12  Aligned_cols=68  Identities=29%  Similarity=0.602  Sum_probs=57.3

Q ss_pred             cccccCcHHHhhcCCCCCCChhHHHhhhcCCccccccccccccccc----------CCCCHHHHhhhhhhcCCCCCC-CC
Q 042956           35 KDGLTACQPAVAASNPSPPSTACCSALSKADLQCFCVFKNSRVLSF----------YGIDFHQAMQLPAKCNLGDSF-HC  103 (103)
Q Consensus        35 ~~~l~~C~~yl~~~~~~~Ps~~CC~~l~~~~~~ClC~~l~~~~~~~----------~~i~~~~a~~Lp~~Cg~~~p~-~c  103 (103)
                      ...+.+|.+|++++. ..|+..||++|+..++.|.|..++......          .+++..+|..||+.||+++|+ .|
T Consensus        12 ~~~l~~c~~~~~~~~-~~~~~~CC~~L~~l~~~C~C~~i~~~~~~~~~q~~~~~~~~~~~~~~a~~LP~~C~v~~~~~~C   90 (90)
T PF00234_consen   12 QVRLSPCLPYLQGGC-QQPSQQCCQQLRQLDPQCRCEAIRQMVRQVIQQQQQGGQEMQIMAQRAQNLPSMCNVSPPYTDC   90 (90)
T ss_dssp             SSHHHGGHHHHTTSS-SHHHHHHHHHHHHHHHHHHHHHHHHHHHHSHHCTSTCSHHHHHHHHHHHHHHHHTTSSSSSS-G
T ss_pred             cccccccHHHHhccc-ccchHHHhHHHHHHhHHhhCHHHHHHHHhhhhhhhhhHHHHHHHHHHHHHHHHHCCCCCCCCCC
Confidence            345899999999864 378999999999999999999999765542          268999999999999999987 66


No 8  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=93.92  E-value=0.052  Score=34.13  Aligned_cols=22  Identities=23%  Similarity=0.169  Sum_probs=14.5

Q ss_pred             CchhhHHHHHHHHHHHHHhhCc
Q 042956            1 MEAYVKLLILAVILGLAIGSVP   22 (103)
Q Consensus         1 M~~~~~~~~~~~v~~l~~~~~~   22 (103)
                      |++++++++.+++++|+|++++
T Consensus         1 MaSK~~llL~l~LA~lLlisSe   22 (95)
T PF07172_consen    1 MASKAFLLLGLLLAALLLISSE   22 (95)
T ss_pred             CchhHHHHHHHHHHHHHHHHhh
Confidence            8866666666666666666664


No 9  
>PF14547 Hydrophob_seed:  Hydrophobic seed protein
Probab=93.68  E-value=0.034  Score=34.32  Aligned_cols=72  Identities=22%  Similarity=0.528  Sum_probs=45.2

Q ss_pred             CccccccccCcHHHhhc----CCCCCCChhHHHhhhc----CCcccccccccccccccCCCCHH-HHhhhhhhcCCCCC-
Q 042956           31 CRMTKDGLTACQPAVAA----SNPSPPSTACCSALSK----ADLQCFCVFKNSRVLSFYGIDFH-QAMQLPAKCNLGDS-  100 (103)
Q Consensus        31 C~~~~~~l~~C~~yl~~----~~~~~Ps~~CC~~l~~----~~~~ClC~~l~~~~~~~~~i~~~-~a~~Lp~~Cg~~~p-  100 (103)
                      |-.+..+|.-|.+.+..    .+ .++...||+-++.    .-..|+|..++.......++|.. ....|-..||...| 
T Consensus         2 CP~d~lkLgvC~~vL~l~~~~~g-~~~~~~CC~li~gL~d~~AA~CLC~aika~vlg~i~~~ipv~l~~lln~CGk~~p~   80 (85)
T PF14547_consen    2 CPRDALKLGVCANVLGLVNLVIG-NPPRQPCCSLIAGLADLDAAVCLCTAIKANVLGLINVNIPVALNLLLNACGKTVPS   80 (85)
T ss_pred             CCCcchhhhhhhhhhhhhccccC-CCCCCCcChHHhCcccchHHHHHHHHHhhhcccccccccccHHHHHHHHhCCcCcC
Confidence            43334466778888721    11 3477899999997    34469999999654432233332 45566688998854 


Q ss_pred             -CCC
Q 042956          101 -FHC  103 (103)
Q Consensus       101 -~~c  103 (103)
                       |.|
T Consensus        81 gf~C   84 (85)
T PF14547_consen   81 GFTC   84 (85)
T ss_pred             CCcC
Confidence             554


No 10 
>cd01958 HPS_like HPS_like: Hydrophobic Protein from Soybean (HPS)-like subfamily; composed of proteins with similarity to HPS, a small hydrophobic protein with unknown function related to cereal-type alpha-amylase inhibitors and lipid transfer proteins. In addition to HPS, members of this subfamily include a hybrid proline-rich protein (HyPRP) from maize, a dark-inducible protein (LeDI-2) from Lithospermum erythrorhizon, maize ZRP3 protein, and rice RcC3 protein. HyPRP is an embryo-specific protein that contains an N-terminal proline-rich domain and a C-terminal HPS-like cysteine-rich domain. It has been suggested that HyPRP may be involved in the stability and defense of the developing embryo. LeDI-2 is a root-specific protein that may be involved in regulating the biosynthesis of shikonin derivatives in L. erythrorhizon. Maize ZRP3 and rice RcC3 are root-specific proteins whose functions are yet to be determined. It has been reported that ZRP3 largely accumulates in a distinct subset
Probab=92.59  E-value=0.23  Score=30.67  Aligned_cols=73  Identities=21%  Similarity=0.475  Sum_probs=44.5

Q ss_pred             CCccccccccCcHHHhhcCC---CCCCChhHHHhhhc----CCcccccccccccccccCCCCH-HHHhhhhhhcCCCCC-
Q 042956           30 LCRMTKDGLTACQPAVAASN---PSPPSTACCSALSK----ADLQCFCVFKNSRVLSFYGIDF-HQAMQLPAKCNLGDS-  100 (103)
Q Consensus        30 ~C~~~~~~l~~C~~yl~~~~---~~~Ps~~CC~~l~~----~~~~ClC~~l~~~~~~~~~i~~-~~a~~Lp~~Cg~~~p-  100 (103)
                      .|-.+...|--|..-+....   ...|..+||.-++.    .-..|+|..++.....+ .+|. -+...+-..||...| 
T Consensus         3 ~CP~dalkLgvCanvL~l~~~~~g~~~~~~CC~ll~GL~dldAA~CLCtaikan~lgi-~~~~pv~l~llln~CGk~~P~   81 (85)
T cd01958           3 TCPRDALKLGVCANVLGLSLLLLGTPAVQPCCPLIGGLADLDAAVCLCTAIKANILGI-SINIPVALSLLLNSCGRNVPP   81 (85)
T ss_pred             CCCcchHHhchhHhhhhccccccCCCccchHHHHHcCchhhheeeeeeeeeeccccCc-ccccChhHHHHHHHHcCcCCC
Confidence            35444445666777663211   13577899999997    34569999999644332 2222 344555578999865 


Q ss_pred             -CCC
Q 042956          101 -FHC  103 (103)
Q Consensus       101 -~~c  103 (103)
                       |.|
T Consensus        82 gf~C   85 (85)
T cd01958          82 GFTC   85 (85)
T ss_pred             CCcC
Confidence             544


No 11 
>cd00261 AAI_SS AAI_SS: Alpha-Amylase Inhibitors (AAIs) and Seed Storage (SS) Protein subfamily; composed of cereal-type AAIs and SS proteins. They are mainly present in the seeds of a variety of plants. AAIs play an important role in the natural defenses of plants against insects and pathogens such as fungi, bacteria and viruses. AAIs impede the digestion of plant starch and proteins by inhibiting digestive alpha-amylases and proteinases. Also included in this subfamily are SS proteins such as 2S albumin, gamma-gliadin, napin, and prolamin. These AAIs and SS proteins are also known allergens in humans.
Probab=89.82  E-value=0.11  Score=32.78  Aligned_cols=68  Identities=24%  Similarity=0.368  Sum_probs=45.8

Q ss_pred             ccccCcHHHhhcCC-CC------------CCChhHHHhhhcCCcccccccccccccccC---------------CCCHHH
Q 042956           36 DGLTACQPAVAASN-PS------------PPSTACCSALSKADLQCFCVFKNSRVLSFY---------------GIDFHQ   87 (103)
Q Consensus        36 ~~l~~C~~yl~~~~-~~------------~Ps~~CC~~l~~~~~~ClC~~l~~~~~~~~---------------~i~~~~   87 (103)
                      ..|.+|..|+.-.. +.            .....||..++..+..|-|..|........               ..-...
T Consensus        13 ~~L~~C~~yl~qq~~~~~~~~~~~~~~~~~~~qqCCqqL~~i~~qcrC~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (110)
T cd00261          13 QPLNSCREYLRQQCSGVGGPPVWPQQSCEVLRQQCCQQLAQIPEQCRCEALRQMVQGVIQQQQQQQEQQQGQEVERMRQA   92 (110)
T ss_pred             ccCcHHHHHHHHhccCCCCCCCcCccccHHHHHHHHHHHHhCcHhhhHHHHHHHHHHHHHhhhccccccCcChHHHHHHH
Confidence            35788999985311 00            113579999999999999999975322110               122458


Q ss_pred             HhhhhhhcCCCCCCCC
Q 042956           88 AMQLPAKCNLGDSFHC  103 (103)
Q Consensus        88 a~~Lp~~Cg~~~p~~c  103 (103)
                      |..||..||+..+..|
T Consensus        93 a~~Lp~~C~~~~~~~C  108 (110)
T cd00261          93 AQNLPSMCNLYPPPYC  108 (110)
T ss_pred             HHhhchhcCCCCCCCC
Confidence            8999999999874445


No 12 
>PF05617 Prolamin_like:  Prolamin-like;  InterPro: IPR008502 This entry consists of several proteins of unknown function found exclusively in Arabidopsis thaliana.
Probab=45.40  E-value=11  Score=21.57  Aligned_cols=21  Identities=24%  Similarity=0.574  Sum_probs=17.5

Q ss_pred             CCCChhHHHhhhcCCcccccc
Q 042956           51 SPPSTACCSALSKADLQCFCV   71 (103)
Q Consensus        51 ~~Ps~~CC~~l~~~~~~ClC~   71 (103)
                      ...+.+||.++...+.+|.=.
T Consensus        26 ~~i~~~CC~~i~~~g~~C~~~   46 (70)
T PF05617_consen   26 KNIGPECCKAINKMGKDCHPA   46 (70)
T ss_pred             CCCChHHHHHHHHHhHhHHHH
Confidence            478899999999988877655


No 13 
>TIGR01165 cbiN cobalt transport protein. This model describes the cobalt transporter in bacteria and its equivalents in archaea. It principally functions in the ion uptake mechanism. It is a multisubunit transporter with two integral membrane proteins and two closely associated cytoplasmic subunits. This transporter belongs to the ABC transporter superfamily (ATP stands for ATP Binding Cassette). This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=40.80  E-value=32  Score=21.45  Aligned_cols=15  Identities=20%  Similarity=0.310  Sum_probs=7.9

Q ss_pred             CchhhHHHHHHHHHH
Q 042956            1 MEAYVKLLILAVILG   15 (103)
Q Consensus         1 M~~~~~~~~~~~v~~   15 (103)
                      |..++.+..++++++
T Consensus         1 m~~~~~~~ll~~v~~   15 (91)
T TIGR01165         1 MSMKKTIWLLAAVAA   15 (91)
T ss_pred             CCcchhHHHHHHHHH
Confidence            666665544444433


No 14 
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=36.63  E-value=23  Score=20.42  Aligned_cols=21  Identities=19%  Similarity=0.301  Sum_probs=11.4

Q ss_pred             CchhhHHHHHHHHHHHHHhhC
Q 042956            1 MEAYVKLLILAVILGLAIGSV   21 (103)
Q Consensus         1 M~~~~~~~~~~~v~~l~~~~~   21 (103)
                      |+..|++..++++++.+...+
T Consensus         1 Mkk~ksifL~l~~~LsA~~FS   21 (61)
T PF15284_consen    1 MKKFKSIFLALVFILSAAGFS   21 (61)
T ss_pred             ChHHHHHHHHHHHHHHHhhhh
Confidence            555566655555555544333


No 15 
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=35.52  E-value=75  Score=18.39  Aligned_cols=18  Identities=22%  Similarity=0.285  Sum_probs=9.9

Q ss_pred             CchhhHHHHHHHHHHHHH
Q 042956            1 MEAYVKLLILAVILGLAI   18 (103)
Q Consensus         1 M~~~~~~~~~~~v~~l~~   18 (103)
                      |+.+-+++.++.++++++
T Consensus         1 MA~Kl~vialLC~aLva~   18 (65)
T PF10731_consen    1 MASKLIVIALLCVALVAI   18 (65)
T ss_pred             CcchhhHHHHHHHHHHHH
Confidence            665555555555555444


No 16 
>PF15240 Pro-rich:  Proline-rich
Probab=34.57  E-value=32  Score=24.06  Aligned_cols=8  Identities=13%  Similarity=0.405  Sum_probs=3.0

Q ss_pred             HHHHHHHH
Q 042956            9 ILAVILGL   16 (103)
Q Consensus         9 ~~~~v~~l   16 (103)
                      +|+|.|+|
T Consensus         3 lVLLSvAL   10 (179)
T PF15240_consen    3 LVLLSVAL   10 (179)
T ss_pred             hHHHHHHH
Confidence            33343333


No 17 
>CHL00132 psaF photosystem I subunit III; Validated
Probab=33.64  E-value=49  Score=23.23  Aligned_cols=34  Identities=24%  Similarity=0.333  Sum_probs=15.7

Q ss_pred             hHHHHHHHHHHHHHhhCcCCCCCCCCCccccccccCcHHH
Q 042956            5 VKLLILAVILGLAIGSVPTGVNGDGLCRMTKDGLTACQPA   44 (103)
Q Consensus         5 ~~~~~~~~v~~l~~~~~~~~~~~~~~C~~~~~~l~~C~~y   44 (103)
                      +++..+++++.+.+...+..+.+      +...|.||.+.
T Consensus         2 rrl~~l~l~~~l~~~~~p~~a~a------d~agLtpCses   35 (185)
T CHL00132          2 KKFNLLFLLLAALLLFNPIAAFA------DVAGLTPCSES   35 (185)
T ss_pred             hhHHHHHHHHHHHHhcCCccccc------cccCCccCccC
Confidence            34444445444444444311221      24567777653


No 18 
>PRK12750 cpxP periplasmic repressor CpxP; Reviewed
Probab=33.27  E-value=52  Score=22.58  Aligned_cols=20  Identities=40%  Similarity=0.630  Sum_probs=13.5

Q ss_pred             CchhhHHHHHHHHHHHHHhh
Q 042956            1 MEAYVKLLILAVILGLAIGS   20 (103)
Q Consensus         1 M~~~~~~~~~~~v~~l~~~~   20 (103)
                      |...|+++++.+++.|++..
T Consensus         1 ~~~~kkl~~~~v~~~l~lg~   20 (170)
T PRK12750          1 MKLAKKLVLAAVVLPLTLGT   20 (170)
T ss_pred             CchHHHHHHHHHHHHHHHHh
Confidence            66778877777666666633


No 19 
>PF10868 DUF2667:  Protein of unknown function (DUF2667);  InterPro: IPR022618  This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana. 
Probab=29.09  E-value=27  Score=21.76  Aligned_cols=6  Identities=17%  Similarity=0.047  Sum_probs=3.7

Q ss_pred             CchhhH
Q 042956            1 MEAYVK    6 (103)
Q Consensus         1 M~~~~~    6 (103)
                      |++.|.
T Consensus         1 m~slk~    6 (90)
T PF10868_consen    1 MGSLKL    6 (90)
T ss_pred             CCceEE
Confidence            666654


No 20 
>PF06411 HdeA:  HdeA/HdeB family;  InterPro: IPR010486 HNS (histone-like nucleoid structuring)-dependent expression A (HdeA) protein is a stress response protein found in highly acid resistant bacteria such as Shigella flexneri and Escherichia coli, but which is lacking in mildly acid tolerant bacteria such as Salmonella []. HdeA is one of the most abundant proteins found in the periplasmic space of E. coli, where it is one of a network of proteins that confer an acid resistance phenotype essential for the pathogenesis of enteric bacteria []. HdeA is thought to act as a chaperone, functioning to prevent the aggregation of periplasmic proteins denatured under acidic conditions. The HNS protein, a chromatin-associated protein that influences the gene expression of several environmentally-induced target genes, represses the expression of HdeA. HdeB, which is encoded within the same operon, may form heterodimers with HdeA. HdeA is a single domain protein with an overall fold that is similar to the fold of the N-terminal subdomain of the GluRS anticodon-binding domain. ; PDB: 1BG8_C 1DJ8_C 2XUV_C.
Probab=29.07  E-value=26  Score=21.40  Aligned_cols=13  Identities=8%  Similarity=0.222  Sum_probs=8.5

Q ss_pred             cccccCcHHHhhc
Q 042956           35 KDGLTACQPAVAA   47 (103)
Q Consensus        35 ~~~l~~C~~yl~~   47 (103)
                      ..+-+.|.+|+.-
T Consensus        30 ~~~~mTC~eFl~l   42 (94)
T PF06411_consen   30 DPSKMTCKEFLDL   42 (94)
T ss_dssp             SGGG-BHHHHHTS
T ss_pred             CchhCcHHHHHcC
Confidence            3455789999864


No 21 
>PLN00019 photosystem I reaction center subunit III; Provisional
Probab=26.33  E-value=87  Score=22.65  Aligned_cols=10  Identities=40%  Similarity=0.820  Sum_probs=6.4

Q ss_pred             cccccCcHHH
Q 042956           35 KDGLTACQPA   44 (103)
Q Consensus        35 ~~~l~~C~~y   44 (103)
                      ..+|.||.+.
T Consensus        66 ~agLtPCses   75 (223)
T PLN00019         66 IAGLTPCKES   75 (223)
T ss_pred             ccCCccCccC
Confidence            5567777653


No 22 
>PF05294 Toxin_5:  Scorpion short toxin;  InterPro: IPR007958 This family contains various secreted scorpion short toxins which seem to be unrelated to those described in IPR001947 from INTERPRO.; GO: 0009405 pathogenesis, 0005576 extracellular region; PDB: 1SIS_A 1CHL_A.
Probab=23.95  E-value=23  Score=17.76  Aligned_cols=16  Identities=38%  Similarity=0.999  Sum_probs=10.8

Q ss_pred             hhHHHhhhc-CCccccc
Q 042956           55 TACCSALSK-ADLQCFC   70 (103)
Q Consensus        55 ~~CC~~l~~-~~~~ClC   70 (103)
                      .+||.+-.+ ..++|+|
T Consensus        16 ~~CCgg~GkC~GpqClC   32 (32)
T PF05294_consen   16 RDCCGGRGKCFGPQCLC   32 (32)
T ss_dssp             HHHCTTSEEEETTEEEE
T ss_pred             HHHhCCCCeEcCCcccC
Confidence            458877654 5777776


No 23 
>PLN00214 putative protein; Provisional
Probab=23.58  E-value=65  Score=20.94  Aligned_cols=24  Identities=21%  Similarity=0.444  Sum_probs=17.2

Q ss_pred             CCCChhHHHhhhcCCccccccccc
Q 042956           51 SPPSTACCSALSKADLQCFCVFKN   74 (103)
Q Consensus        51 ~~Ps~~CC~~l~~~~~~ClC~~l~   74 (103)
                      .++|..||+.+-+.++.|-=..++
T Consensus        59 ~t~s~~CC~~LVk~GK~CH~~LiK   82 (115)
T PLN00214         59 GTLIDPCCNDLVKEGKVCHDTLIK   82 (115)
T ss_pred             CCCchHHHHHHHHHhhHHHHHHHH
Confidence            357899999988877766544444


No 24 
>PRK00059 prsA peptidylprolyl isomerase; Provisional
Probab=22.50  E-value=91  Score=23.10  Aligned_cols=18  Identities=17%  Similarity=0.159  Sum_probs=12.3

Q ss_pred             CchhhHHHHHHHHHHHHH
Q 042956            1 MEAYVKLLILAVILGLAI   18 (103)
Q Consensus         1 M~~~~~~~~~~~v~~l~~   18 (103)
                      |...|+++..+++.++++
T Consensus         1 ~~~~~~~~~~~~~~~l~~   18 (336)
T PRK00059          1 MKSIKKLVASLLVGVFIF   18 (336)
T ss_pred             CchHHHHHHHHHHHHHHH
Confidence            778888777666655544


No 25 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=20.37  E-value=80  Score=21.21  Aligned_cols=13  Identities=38%  Similarity=0.427  Sum_probs=5.8

Q ss_pred             hhHHHHHHHHHHH
Q 042956            4 YVKLLILAVILGL   16 (103)
Q Consensus         4 ~~~~~~~~~v~~l   16 (103)
                      +|+++.+++++++
T Consensus        15 kkkl~ii~l~~l~   27 (162)
T PRK07021         15 KRKLWLIILILLL   27 (162)
T ss_pred             ccchhHHHHHHHH
Confidence            4455444444333


Done!