Citrus Sinensis ID: 042958

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070-----
MEEAHALLRWKTSLQNHNNGSLLSSWTLNNVTKTSPCAWVGIHCNRGGRVNSINLTSIGLKGMLHDFSFSSFPHLAYLDLWHNQLYGNIPPQIGNISRLKYLDLSSNLFFGTIPPEIGHLSYLKTLQLFENQLNGSIPYEIGRLSSLNYLALYSNYLEDLIPPSLGNLSNLDTLHLYDNSLSDSIPSEFGNLRSLSMLSLGYNKFSGSIPHSLGNLTNLATLYLHNNSLFDSIPSELGNLRSLSMLSLGYNKLSGSIPHSLGNLTNLATLYLYENSLSGSIPSEFGNLRSLSMLNLGYNKLNGIIPHSLGNLTNLATLYIHNNSLSGSIPSEIGNLRSLSNLGLSGNKLSGSIPPSLGYLSNLATLYLYSNSLFDSIPSELGNLRSLSMLSLGYNKLSGSIPHSLGNLTNLATLDLYDNSLSGSIPSEFGNLRSLSTLSLGYNKLSGSIPHSLGNLTNLDALYLYDNSLSGSIPGEIGNLRSISNLALNNNKLSGSIPQSLGNLSNLVILYLYNNSLFDSIPSELGNLRSLSMLSFAYNKLSGSIPHSLGVLDLSSNHIVGEIPTELGKLNFLIKLILAQNQLSGQLSPKLGSLAQLEHLDLSSNRLSNSIPKSFGNLVKLHYLNLSNNQFSRGIPIKLEELIHLSELDLSHNFLREAIPSQICIMQSLENLNLSHNSLVGLIPSCFEKMHGLLRIDISYNELQGPIPNSIAFRDAPIEALQGNKGLCGDVKGLPSCKTLKSNKQALRKIWVVVVFPLLGIVALLISLIGLFFKFQRRNNDLQTQQSSPGNTRGLLSVLTFEGKIVYEEIIRATNDFDDEHCIGKGGQGSVYKAELASGEIVAVKKFHSPLPGEMTFQQEFLNEVKALTEIRHRNIVKFYGFCSHVRHSLAMILSNNAAAKDLGWTRRMNVIKGISDALSYMHNDCFPPIVHRDISSKNVLLDFDNEAHVSDFGIAKFLKPDSSNWTELAGTYGYVAPELAYTMKVTEKCDVYSFGVLALEVIKGKHPRDFISSMSSSSLNLNIALDEMLDPRLPTPSCIVQDKLISIVEVAISCLDENPESRPTMPKVSQLLKI
ccHHHHHHHHHHccccccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccCCcccccccccccccEEEcccccccccccccccccccccEEEccccccCEcccccccccccccEEEccccccCEcccccccccccccEEEcccccccccccccccccccccEEEccccccCCcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccCEECccccHHccccccccEEccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccEEEccccCEEECccccccccccccEEEcccccccccccHHcccccccccEEccccCEEECccccccccccccEEEccccEEECcccccccccccccEEEccccCEEEcccccccccccccEEEccccccccccccccccEEcccccccccccccccccccccEEEcccccccccccHHHcccccccccccccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccccccccccccccccHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccccccEEccccccEEEEEECccccEEEEEEEcccccccccccHHHHHHHHHHccccccccccEEEEEEcccccHHHHcccccccccccHHHHHHHHHHHHHHHcccccccccccEEccccccccccccccCEEEccccccccccccccccCEcCEEEECcccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcc
MEEAHALLRWKTSLQNHNNGSLLSSWTLNNVTKTSPCAWVGIHCNRGGRVNSINLTSIGLKGMLHDFSFSSFPHLAYLDLWHNQLYGNIPPQIGNISRLKYLDLSSNLFFGTIPPEIGHLSYLKTLQLFENQLNGSIPYEIGRLSSLNYLALYSNYLEDLIPPSLGNLSNLDTLHLYDNSLSDSIPSEFGNLRSLSMLSLGYNKFSGSIPHSLGNLTNLATLYLHNNSLFDSIPSELGNLRSLSMLSLGYNKLSGSIPHSLGNLTNLATLYLYENSLSGSIPSEFGNLRSLSMLNLGYNKLNGIIPHSLGNLTNLATLYIHNNSLSGSIPSEIGNLRSLSNLGLSGNKLSGSIPPSLGYLSNLATLYLYSNSLFDSIPSELGNLRSLSMLSLGYNKLSGSIPHSLGNLTNLATLDLYDNSLSGSIPSEFGNLRSLSTLSLGYNKLSGSIPHSLGNLTNLDALYLYDNSLSGSIPGEIGNLRSISNLALNNNKLSGSIPQSLGNLSNLVILYLYNNSLFDSIPSELGNLRSLSMLSFAYNKLSGSIPHSLGVLDLSSNHIVGEIPTELGKLNFLIKLILAQNQLSGQLSPKLGSLAQLEHLDLSSNRLSNSIPKSFGNLVKLHYLNLSNNQFSRGIPIKLEELIHLSELDLSHNFLREAIPSQICIMQSLENLNLSHNSLVGLIPSCFEKMHGLLRIDISYNELQGPIPNSIAFRDAPIEALQGNKGLCGDVKGLPSCK******QALRKIWVVVVFPLLGIVALLISLIGLFFKFQR****************GLLSVLTFEGKIVYEEIIRATNDFDDEHCIGKGGQGSVYKAELASGEIVAVKKFHSPLPGEMTFQQEFLNEVKALTEIRHRNIVKFYGFCSHVRHSLAMILSNNAAAKDLGWTRRMNVIKGISDALSYMHNDCFPPIVHRDISSKNVLLDFDNEAHVSDFGIAKFLKPDSSNWTELAGTYGYVAPELAYTMKVTEKCDVYSFGVLALEVIKGKHPRDFISSMSSSSLNLNIALDEMLDPRLPTPSCIVQDKLISIVEVAISCLDENPESRPT*PKVS**LK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEAHALLRWKTSLQNHNNGSLLSSWTLNNVTKTSPCAWVGIHCNRGGRVNSINLTSIGLKGMLHDFSFSSFPHLAYLDLWHNQLYGNIPPQIGNISRLKYLDLSSNLFFGTIPPEIGHLSYLKTLQLFENQLNGSIPYEIGRLSSLNYLALYSNYLEDLIPPSLGNLSNLDTLHLYDNSLSDSIPSEFGNLRSLSMLSLGYNKFSGSIPHSLGNLTNLATLYLHNNSLFDSIPSELGNLRSLSMLSLGYNKLSGSIPHSLGNLTNLATLYLYENSLSGSIPSEFGNLRSLSMLNLGYNKLNGIIPHSLGNLTNLATLYIHNNSLSGSIPSEIGNLRSLSNLGLSGNKLSGSIPPSLGYLSNLATLYLYSNSLFDSIPSELGNLRSLSMLSLGYNKLSGSIPHSLGNLTNLATLDLYDNSLSGSIPSEFGNLRSLSTLSLGYNKLSGSIPHSLGNLTNLDALYLYDNSLSGSIPGEIGNLRSISNLALNNNKLSGSIPQSLGNLSNLVILYLYNNSLFDSIPSELGNLRSLSMLSFAYNKLSGSIPHSLGVLDLSSNHIVGEIPTELGKLNFLIKLILAQNQLSGQLSPKLGSLAQLEHLDLSSNRLSNSIPKSFGNLVKLHYLNLSNNQFSRGIPIKLEELIHLSELDLSHNFLREAIPSQICIMQSLENLNLSHNSLVGLIPSCFEKMHGLLRIDISYNELQGPIPNSIAFRDAPIEALQGNKGLCGDVKGLPSCKTLKSNKQALRKIWVVVVFPLLGIVALLISLIGLFFKFQRRNNDLQTQQSSPGNTRGLLSVLTFEGKIVYEEIIRATNDFDDEHCIGKGGQGSVYKAELASGEIVAVKKFHSPLPGEMTFQQEFLNEVKALTEIRHRNIVKFYGFCSHVRHSLAMILSNNAAAKDLGWTRRMNVIKGISDALSYMHNDCFPPIVHRDISSKNVLLDFDNEAHVSDFGIAKFLKPDSSNWTELAGTYGYVAPELAYTMKVTEKCDVYSFGVLALEVIKGKHPRDFISSMSSSSLNLNIALDEMLDPRLPTPSCIVQDKLISIVEVAISCLDENPESRPTMPKVSQLLKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable leucine-rich repeat receptor-like protein kinase At1g35710 probableQ9LP24

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E6J, chain A
Confidence level:very confident
Coverage over the Query: 76-140,165-255
View the alignment between query and template
View the model in PyMOL
Template: 2WFH, chain A
Confidence level:very confident
Coverage over the Query: 577-708
View the alignment between query and template
View the model in PyMOL
Template: 1W8A, chain A
Confidence level:very confident
Coverage over the Query: 550-683
View the alignment between query and template
View the model in PyMOL
Template: 1W8A, chain A
Confidence level:very confident
Coverage over the Query: 410-519
View the alignment between query and template
View the model in PyMOL
Template: 3E6J, chain A
Confidence level:very confident
Coverage over the Query: 37-48,60-134
View the alignment between query and template
View the model in PyMOL
Template: 3M19, chain A
Confidence level:very confident
Coverage over the Query: 36-62,89-255
View the alignment between query and template
View the model in PyMOL
Template: 2O6S, chain A
Confidence level:very confident
Coverage over the Query: 76-140,165-290
View the alignment between query and template
View the model in PyMOL
Template: 3M19, chain A
Confidence level:very confident
Coverage over the Query: 98-140,165-304
View the alignment between query and template
View the model in PyMOL
Template: 2Z7X, chain B
Confidence level:very confident
Coverage over the Query: 172-338,362-543,563-564,586-708
View the alignment between query and template
View the model in PyMOL
Template: 2Z7X, chain B
Confidence level:very confident
Coverage over the Query: 76-543
View the alignment between query and template
View the model in PyMOL
Template: 4FCG, chain A
Confidence level:very confident
Coverage over the Query: 2-49,63-168,184-326
View the alignment between query and template
View the model in PyMOL
Template: 3O6N, chain A
Confidence level:very confident
Coverage over the Query: 385-730
View the alignment between query and template
View the model in PyMOL
Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 900-1074
View the alignment between query and template
View the model in PyMOL
Template: 3GOP, chain A
Confidence level:probable
Coverage over the Query: 791-844,856-954,973-1074
View the alignment between query and template
View the model in PyMOL
Template: 2KS1, chain B
Confidence level:probable
Coverage over the Query: 774-780
View the alignment between query and template
View the model in PyMOL