Query         042971
Match_columns 80
No_of_seqs    104 out of 567
Neff          6.5 
Searched_HMMs 46136
Date          Fri Mar 29 11:27:44 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/042971.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/042971hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02629 powdery mildew resist  99.9 7.6E-23 1.7E-27  152.6   7.3   76    1-79    216-303 (387)
  2 PF13839 PC-Esterase:  GDSL/SGN  98.7 2.3E-08 4.9E-13   68.7   5.4   47   25-71    125-179 (263)
  3 PF06462 Hyd_WA:  Propeller;  I  73.3     4.2 9.2E-05   20.1   2.2   21   45-65      8-29  (32)
  4 PF15590 Imm15:  Immunity prote  47.9      19 0.00041   21.3   2.1   20   43-62     31-50  (69)
  5 PF03199 GSH_synthase:  Eukaryo  46.8     2.8 6.1E-05   26.4  -1.7   19   47-65     64-84  (105)
  6 PF04895 DUF651:  Archaeal prot  39.3      92   0.002   19.8   4.4   38   28-65     14-54  (110)
  7 PF11623 DUF3252:  Protein of u  36.7     5.9 0.00013   22.2  -1.2    9   58-66     35-43  (53)
  8 PF14365 DUF4409:  Domain of un  36.7      15 0.00032   23.3   0.5   16   63-78     56-72  (117)
  9 PF00976 ACTH_domain:  Corticot  33.9      25 0.00054   18.5   1.0   12   53-67      1-12  (39)
 10 PF05224 NDT80_PhoG:  NDT80 / P  31.8      24 0.00052   24.0   1.0   15   47-61    171-185 (186)
 11 PF13304 AAA_21:  AAA domain; P  31.6      64  0.0014   20.4   2.9   23   35-57    278-300 (303)
 12 COG0180 TrpS Tryptophanyl-tRNA  29.8      32 0.00069   25.7   1.4   27   35-61     69-96  (314)
 13 COG4443 Uncharacterized protei  23.3      31 0.00067   20.3   0.2   15   48-62     38-52  (72)

No 1  
>PLN02629 powdery mildew resistance 5
Probab=99.88  E-value=7.6e-23  Score=152.61  Aligned_cols=76  Identities=20%  Similarity=0.473  Sum_probs=68.4

Q ss_pred             CCCCCCCCCCCCCceEeccCeeccCCCChHHHhH-----HHHHHHHh-CCCCceEEEEeccCCcccCCCCCCCC-----C
Q 042971            1 WWAPAKFDPVKSPMLFFEKDKPVIPPVQPNVGLD-----MIQYVEKT-ARPGSIKLFRTQSPRHFEGVDWDQGG-----S   69 (80)
Q Consensus         1 WW~~~~~~~~~~~~~y~~~g~~v~~~~~~~~a~r-----~~~wv~~~-~~~kt~vffrT~SP~Hfe~g~W~~Gg-----~   69 (80)
                      ||++.+.   +++++|++.|..++++|++.+|||     |++||+.+ ++.+++|||||+||+|||+|+||+||     +
T Consensus       216 Ww~~~~~---~~~~~~~~~g~~~~~~~~~~~A~r~al~T~~~wv~~~~~~~kt~vffrT~SP~Hfe~g~Wn~gg~~~~~~  292 (387)
T PLN02629        216 WWSHQGS---LQGWDYIESGGTYYQDMDRLVALEKALRTWAYWVDTNVDRSRTRVFFQSISPTHYNPSEWSAGASTTTKN  292 (387)
T ss_pred             ccCCCCe---eEEeeeeccCCccccCccHHHHHHHHHHHHHHHHHhcCCCCCcEEEEEecCcccccCCCcCCCCCCCCCC
Confidence            8999887   889999999999999999999998     88999987 78899999999999999999999875     5


Q ss_pred             cc-ccccCCCC
Q 042971           70 CQ-RLQPLLPE   79 (80)
Q Consensus        70 C~-~T~P~~~~   79 (80)
                      |+ +|+|+.++
T Consensus       293 C~~et~P~~~~  303 (387)
T PLN02629        293 CYGETTPMSGM  303 (387)
T ss_pred             CccCCccCcCc
Confidence            87 59998753


No 2  
>PF13839 PC-Esterase:  GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p
Probab=98.73  E-value=2.3e-08  Score=68.72  Aligned_cols=47  Identities=36%  Similarity=0.768  Sum_probs=39.6

Q ss_pred             CCCChHHHhH-----HHHHHHHh-CCCC--ceEEEEeccCCcccCCCCCCCCCcc
Q 042971           25 PPVQPNVGLD-----MIQYVEKT-ARPG--SIKLFRTQSPRHFEGVDWDQGGSCQ   71 (80)
Q Consensus        25 ~~~~~~~a~r-----~~~wv~~~-~~~k--t~vffrT~SP~Hfe~g~W~~Gg~C~   71 (80)
                      .++....+|+     ++++|... ++.+  ++||||+++|.||++++|++||.|+
T Consensus       125 ~~~~~~~~y~~~l~~~~~~~~~~~~~~~~~~~v~~r~~~P~h~~~~~~~~gg~c~  179 (263)
T PF13839_consen  125 KEINPLEAYRNRLRTLADWVRRLLDRSKPPTRVFWRTTSPVHFEGGDWNSGGSCN  179 (263)
T ss_pred             cCcchHHHHHHHHHHHHHHHHhhhccccccceEEEEecCCccccccccccCCCcC
Confidence            5667778887     67777765 5555  8999999999999999999999998


No 3  
>PF06462 Hyd_WA:  Propeller;  InterPro: IPR006624  Tectonins I and II are two dominant proteins in the nuclei and nuclear matrix from plasmodia of Physarum polycephalum (Slime mold) which encode 217 and 353 amino acids, respectively. Tectonin I is homologous to the C-terminal two-thirds of tectonin II. Both proteins contain six tandem repeats that are each 33-37 amino acids in length and define a new consensus sequence. Homologous repeats are found in L-6, a bacterial lipopolysaccharide-binding lectin from horseshoe crab hemocytes. The repetitive sequences of the tectonins and L-6 are reminiscent of the WD repeats of the beta-subunit of G proteins, suggesting that they form beta-propeller domains. The tectonins may be lectins that function as part of a transmembrane signalling complex during phagocytosis [].
Probab=73.29  E-value=4.2  Score=20.10  Aligned_cols=21  Identities=38%  Similarity=0.703  Sum_probs=17.2

Q ss_pred             CCceEEEEe-ccCCcccCCCCC
Q 042971           45 PGSIKLFRT-QSPRHFEGVDWD   65 (80)
Q Consensus        45 ~kt~vffrT-~SP~Hfe~g~W~   65 (80)
                      ..+.||+|+ +||+.-++-.|.
T Consensus         8 ~~G~v~~R~Gis~~~P~G~~W~   29 (32)
T PF06462_consen    8 SDGSVYFRTGISPSNPEGTSWE   29 (32)
T ss_pred             CCCCEEEECcCCCCCCCCCCcE
Confidence            457899997 999988888784


No 4  
>PF15590 Imm15:  Immunity protein 15
Probab=47.90  E-value=19  Score=21.25  Aligned_cols=20  Identities=10%  Similarity=0.049  Sum_probs=17.9

Q ss_pred             CCCCceEEEEeccCCcccCC
Q 042971           43 ARPGSIKLFRTQSPRHFEGV   62 (80)
Q Consensus        43 ~~~kt~vffrT~SP~Hfe~g   62 (80)
                      ||.+.+--..++.++|+.||
T Consensus        31 DP~D~r~W~~~~~~s~~hGG   50 (69)
T PF15590_consen   31 DPRDGRYWEKSYPESHMHGG   50 (69)
T ss_pred             CCCCCceeEEecCcccccCC
Confidence            78888999999999999975


No 5  
>PF03199 GSH_synthase:  Eukaryotic glutathione synthase;  InterPro: IPR004887 This entry represents the substrate-binding domain of glutathione synthetase (6.3.2.3 from EC) (GSS), a homodimeric enzyme that catalyses the conversion of gamma-L-glutamyl-L-cysteine and glycine to phosphate and glutathione in the presence of ATP. This is the second step in glutathione biosynthesis, the first step being catalysed by gamma-glutamylcysteine synthetase []. In humans, defects in GSS are inherited in an autosomal recessive way and are the cause of severe metabolic acidosis, 5-oxoprolinuria, and increased rate of haemolysis and defective function of the central nervous system. The substrate-binding domain has a 3-layer alpha/beta/alpha structure [].; GO: 0004363 glutathione synthase activity, 0005524 ATP binding, 0006750 glutathione biosynthetic process; PDB: 3KAJ_A 3KAL_A 3KAK_A 2WYO_A 2HGS_A 1M0W_B 1M0T_A.
Probab=46.76  E-value=2.8  Score=26.39  Aligned_cols=19  Identities=26%  Similarity=0.761  Sum_probs=12.7

Q ss_pred             ceEEEE-eccCCccc-CCCCC
Q 042971           47 SIKLFR-TQSPRHFE-GVDWD   65 (80)
Q Consensus        47 t~vffr-T~SP~Hfe-~g~W~   65 (80)
                      .+|.|| +|+|+||- ..+|+
T Consensus        64 sVVYfRaGY~P~dy~se~~W~   84 (105)
T PF03199_consen   64 SVVYFRAGYTPDDYPSEKEWE   84 (105)
T ss_dssp             EEEEECS-SSGGG-SSHHHHH
T ss_pred             EEEEEecCcChhhCCcHHHHH
Confidence            478898 59999993 45565


No 6  
>PF04895 DUF651:  Archaeal protein of unknown function (DUF651);  InterPro: IPR006979 This conserved region is found in the C-terminal region of a number of conserved archaeal proteins of unknown function.
Probab=39.32  E-value=92  Score=19.79  Aligned_cols=38  Identities=13%  Similarity=0.384  Sum_probs=28.2

Q ss_pred             ChHHHhH--HHHHHHHhCCCCceEEEEeccCCccc-CCCCC
Q 042971           28 QPNVGLD--MIQYVEKTARPGSIKLFRTQSPRHFE-GVDWD   65 (80)
Q Consensus        28 ~~~~a~r--~~~wv~~~~~~kt~vffrT~SP~Hfe-~g~W~   65 (80)
                      +-++|-|  ++.++.+.....+.++||-++|.=+- -|-|.
T Consensus        14 G~YYAaRLaVlE~L~~~~RQA~viv~REI~p~Y~~PlGvW~   54 (110)
T PF04895_consen   14 GAYYAARLAVLEYLRRRRRQAGVIVLREITPEYYAPLGVWQ   54 (110)
T ss_pred             hHHHHHHHHHHHHHHHcCccceEEEEEEecCCceeeeeeeh
Confidence            4556666  78888776666678999999998755 36675


No 7  
>PF11623 DUF3252:  Protein of unknown function (DUF3252);  InterPro: IPR021659  This family of proteins has no known function. Some members are annotated as Ssl0352 however this cannot be confirmed. Currently there is no known function. ; PDB: 3C4S_B 2JZ2_A.
Probab=36.71  E-value=5.9  Score=22.21  Aligned_cols=9  Identities=56%  Similarity=1.280  Sum_probs=7.2

Q ss_pred             cccCCCCCC
Q 042971           58 HFEGVDWDQ   66 (80)
Q Consensus        58 Hfe~g~W~~   66 (80)
                      =||+|.|++
T Consensus        35 LFEGGnWdK   43 (53)
T PF11623_consen   35 LFEGGNWDK   43 (53)
T ss_dssp             EEEETTEEE
T ss_pred             EecCCCceE
Confidence            478999975


No 8  
>PF14365 DUF4409:  Domain of unknown function (DUF4409)
Probab=36.68  E-value=15  Score=23.34  Aligned_cols=16  Identities=38%  Similarity=0.806  Sum_probs=12.9

Q ss_pred             CCCCCCCccc-cccCCC
Q 042971           63 DWDQGGSCQR-LQPLLP   78 (80)
Q Consensus        63 ~W~~Gg~C~~-T~P~~~   78 (80)
                      -|..+|.|.. |.|++.
T Consensus        56 ~w~~~g~CP~GTVPIrR   72 (117)
T PF14365_consen   56 LWHQNGSCPEGTVPIRR   72 (117)
T ss_pred             hhccccCCcCCceeeec
Confidence            5777789995 999875


No 9  
>PF00976 ACTH_domain:  Corticotropin ACTH domain;  InterPro: IPR013531 Pro-opiomelanocortin is present in high levels in the pituitary and is processed into 3 major peptide families: adrenocorticotrophin (ACTH); alpha-, beta- and gamma-melanocyte- stimulating hormones (MSH); and beta-endorphin []. ACTH regulates the synthesis and release of glucocorticoids and, to some extent, aldosterone in the adrenal cortex. It is synthesised and released in response to corticotrophin-releasing factor at times of stress (i.e. heat, cold, infection, etc.), its release leading to increased metabolism. The action of MSH in man is poorly understood, but it may be involved in temperature regulation []. Full activity of ACTH resides in the first 20 N-terminal amino acids, the first 13 of which are identical to alpha-MSH [, ]. The function of this region is not known, though it is found near the centre of these proteins.
Probab=33.86  E-value=25  Score=18.46  Aligned_cols=12  Identities=33%  Similarity=0.766  Sum_probs=8.9

Q ss_pred             eccCCcccCCCCCCC
Q 042971           53 TQSPRHFEGVDWDQG   67 (80)
Q Consensus        53 T~SP~Hfe~g~W~~G   67 (80)
                      +||-.||+   |++.
T Consensus         1 Sy~mehfr---wgkp   12 (39)
T PF00976_consen    1 SYSMEHFR---WGKP   12 (39)
T ss_pred             Ccccccee---ccCC
Confidence            57889998   6653


No 10 
>PF05224 NDT80_PhoG:  NDT80 / PhoG like DNA-binding  family;  InterPro: IPR024061 The NDT80 DNA-binding domain is found in the following proteins, which might all be involved in sensing nutritional status []:   Yeast meiosis-specific transcription factor NDT80, the key transcription factor that ultimately allows the continuation of meiosis after the successful completion of recombination.  Emericella nidulans phoG (xprG), a transcriptional activator involved in the response to nutrient limitation.  Emericella nidulans putative uncharacterised protein AN6015.2.  Neurospora crassa transcription factor vib-1, involved in the control of heterokaryon incompatibility.  Neurospora crassa related to acid phosphatase NCU04729.  Neurospora crassa related to meiosis-specific protein NDT80 NCU09915.  The proteolytically resistant core NDT80 DNA-binding domain reveals a central beta-sandwich characteristic of an s-type Ig fold. The beta-sandwich contains a three-stranded sheet composed of strands a, b and e, packed against a four-stranded sheet composed of strands c', c, f and g. Each sheet of the beta-sandwich contains an additional beta-strand, as well as a variety of peripheral secondary structure elements. The NDT80 DNA-binding domain contains an N-terminal extension, which consists of a beta-hairpin and a loop []. ; GO: 0003677 DNA binding; PDB: 2EVJ_A 2EUW_A 1M6U_A 2EVF_A 1M7U_B 1MN4_A 2EVG_A 2EUV_A 2EVI_A 2EVH_A ....
Probab=31.85  E-value=24  Score=23.97  Aligned_cols=15  Identities=27%  Similarity=0.572  Sum_probs=10.2

Q ss_pred             ceEEEEeccCCcccC
Q 042971           47 SIKLFRTQSPRHFEG   61 (80)
Q Consensus        47 t~vffrT~SP~Hfe~   61 (80)
                      .-+++|+=||+||.+
T Consensus       171 ~piIVRGRSP~~Y~~  185 (186)
T PF05224_consen  171 PPIIVRGRSPGHYQS  185 (186)
T ss_dssp             S-EEEE-S-GGGSGG
T ss_pred             CCEEEECCCcccccC
Confidence            358999999999975


No 11 
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=31.61  E-value=64  Score=20.36  Aligned_cols=23  Identities=17%  Similarity=0.342  Sum_probs=15.0

Q ss_pred             HHHHHHHhCCCCceEEEEeccCC
Q 042971           35 MIQYVEKTARPGSIKLFRTQSPR   57 (80)
Q Consensus        35 ~~~wv~~~~~~kt~vffrT~SP~   57 (80)
                      .++.+......+.|||+.|-||.
T Consensus       278 l~~~l~~~~~~~~QviitTHSp~  300 (303)
T PF13304_consen  278 LIELLKELSKKNIQVIITTHSPF  300 (303)
T ss_dssp             HHHHHHHTGGGSSEEEEEES-GG
T ss_pred             HHHHHHhhCccCCEEEEeCccch
Confidence            55666443234689999999984


No 12 
>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=29.77  E-value=32  Score=25.67  Aligned_cols=27  Identities=19%  Similarity=0.267  Sum_probs=23.3

Q ss_pred             HHHHHHHh-CCCCceEEEEeccCCcccC
Q 042971           35 MIQYVEKT-ARPGSIKLFRTQSPRHFEG   61 (80)
Q Consensus        35 ~~~wv~~~-~~~kt~vffrT~SP~Hfe~   61 (80)
                      ++.||..- ||.|+.+|+.|--|.|.+-
T Consensus        69 ~a~~LA~GiDP~k~~if~QS~v~e~~eL   96 (314)
T COG0180          69 AADYLAVGLDPEKSTIFLQSEVPEHAEL   96 (314)
T ss_pred             HHHHHHhccCccccEEEEccCchHHHHH
Confidence            67787765 8999999999999999884


No 13 
>COG4443 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.25  E-value=31  Score=20.34  Aligned_cols=15  Identities=27%  Similarity=0.058  Sum_probs=11.2

Q ss_pred             eEEEEeccCCcccCC
Q 042971           48 IKLFRTQSPRHFEGV   62 (80)
Q Consensus        48 ~vffrT~SP~Hfe~g   62 (80)
                      .-=+|+.||+|-.=|
T Consensus        38 KyDiR~Wspdh~KMG   52 (72)
T COG4443          38 KYDIRAWSPDHSKMG   52 (72)
T ss_pred             cCcccccCcchhhhc
Confidence            345799999997643


Done!