Citrus Sinensis ID: 042977


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-
MGNCCSNGKDESEKEEKATAGNGGVNDGAGGNGTMDTPPKTGPQSSPIPSSGASNKGGGGGKPGAIGPVLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVQIIHTCHSMGVIHRDLKPENFLLLNKDENSPLKATDFGLSVFYKQGEVFKDIVGSAYYIAPEVLKRKYGPEADIWSIGVMLYILLCGVPPFWAESEHGIFNAILRGHIDFTSDPWPSISPQAKDLVKKMLNSDPKQRLTATEVLAHPWIKEDGEAPDVPLDNAVLSRLKQFKAMNKFKKVALRVIAGCLSEEEIMGLKEMFKSIDTDNSGTITLEELKQGLAKQGTKLSEYEAKQLMEAADADGNGTIDYHEFITATMHLNRMDREEHLYTAFQHFDKDNS
cccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccEEEEEECcccccCEEEEEEEccccccHHHHHHHHHHHHHHHHccccccEEEEEEEEECcccEEEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEECccccccccccccEEcccccccccccHHccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccEEHHHHHHHHccccccccHHHHHHHHHHHccccc
**********************************************************************GRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVQIIHTCHSMGVIHRDLKPENFLLLNKDENSPLKATDFGLSVFYKQGEVFKDIVGSAYYIAPEVLKRKYGPEADIWSIGVMLYILLCGVPPFWAESEHGIFNAILRGHIDFTSDPWPSISPQAKDLVKKMLNSDPKQRLTATEVLAHPWIKEDGEAPDVPLDNAVLSRLKQFKAMNKFKKVALRVIAGCLSEEEIMGLKEMFKSIDTDNSGTITLEELKQGLAKQGTKLSEYEAKQLMEAADADGNGTIDYHEFITATMHLNRMDREEHLYTAFQHFDKDN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNCCSNGKDESEKEEKATAGNGGVNDGAGGNGTMDTPPKTGPQSSPIPSSGASNKGGGGGKPGAIGPVLGRPMEDVKATYSFGKELGRGQFGITHLCTHKGTGQQFACKTIAKRKLVNKEDIEDVRREVQIMHHLTGQPNIVELKGAYEDKQSVHLVMELCAGGELFDRIIAKGHYTERAAASLLRTIVQIIHTCHSMGVIHRDLKPENFLLLNKDENSPLKATDFGLSVFYKQGEVFKDIVGSAYYIAPEVLKRKYGPEADIWSIGVMLYILLCGVPPFWAESEHGIFNAILRGHIDFTSDPWPSISPQAKDLVKKMLNSDPKQRLTATEVLAHPWIKEDGEAPDVPLDNAVLSRLKQFKAMNKFKKVALRVIAGCLSEEEIMGLKEMFKSIDTDNSGTITxxxxxxxxxxxxxxxxxxxxxQLMEAADADGNGTIDYHEFITATMHLNRMDREEHLYTAFQHFDKDNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcium-dependent protein kinase 17 May play a role in signal transduction pathways that involve calcium as a second messenger.confidentQ9FMP5
Calcium-dependent protein kinase 2 May play a role in signal transduction pathways that involve calcium as a second messenger.probableP49101
Calcium-dependent protein kinase 34 May play a role in signal transduction pathways that involve calcium as a second messenger.probableQ3E9C0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AAO, chain A
Confidence level:very confident
Coverage over the Query: 365-471
View the alignment between query and template
View the model in PyMOL
Template: 3Q5I, chain A
Confidence level:very confident
Coverage over the Query: 69-471
View the alignment between query and template
View the model in PyMOL
Template: 1UU3, chain A
Confidence level:very confident
Coverage over the Query: 75-341
View the alignment between query and template
View the model in PyMOL