BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 042991
(93 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1OXB|B Chain B, Complex Between Ypd1 And Sln1 Response Regulator Domain
In Space Group P2(1)2(1)2(1)
pdb|1OXK|B Chain B, Complex Between Ypd1 And Sln1 Response Regulator Domain
In Space Group P3(2)
pdb|1OXK|D Chain D, Complex Between Ypd1 And Sln1 Response Regulator Domain
In Space Group P3(2)
pdb|1OXK|F Chain F, Complex Between Ypd1 And Sln1 Response Regulator Domain
In Space Group P3(2)
pdb|1OXK|H Chain H, Complex Between Ypd1 And Sln1 Response Regulator Domain
In Space Group P3(2)
pdb|1OXK|J Chain J, Complex Between Ypd1 And Sln1 Response Regulator Domain
In Space Group P3(2)
pdb|1OXK|L Chain L, Complex Between Ypd1 And Sln1 Response Regulator Domain
In Space Group P3(2)
Length = 134
Score = 26.2 bits (56), Expect = 5.0, Method: Compositional matrix adjust.
Identities = 9/31 (29%), Positives = 20/31 (64%)
Query: 3 DSFVDRKVIERLLTISSSRDLYCSCSGRRAL 33
D+ V+++VI+R+L + ++ +C G+ A
Sbjct: 9 DNHVNQEVIKRMLNLEGIENIELACDGQEAF 39
>pdb|2R25|B Chain B, Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef3-
Length = 133
Score = 26.2 bits (56), Expect = 5.3, Method: Compositional matrix adjust.
Identities = 9/31 (29%), Positives = 20/31 (64%)
Query: 3 DSFVDRKVIERLLTISSSRDLYCSCSGRRAL 33
D+ V+++VI+R+L + ++ +C G+ A
Sbjct: 10 DNHVNQEVIKRMLNLEGIENIELACDGQEAF 40
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.138 0.402
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,587,189
Number of Sequences: 62578
Number of extensions: 87039
Number of successful extensions: 130
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 128
Number of HSP's gapped (non-prelim): 2
length of query: 93
length of database: 14,973,337
effective HSP length: 60
effective length of query: 33
effective length of database: 11,218,657
effective search space: 370215681
effective search space used: 370215681
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)