BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 042991
         (93 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1OXB|B Chain B, Complex Between Ypd1 And Sln1 Response Regulator Domain
          In Space Group P2(1)2(1)2(1)
 pdb|1OXK|B Chain B, Complex Between Ypd1 And Sln1 Response Regulator Domain
          In Space Group P3(2)
 pdb|1OXK|D Chain D, Complex Between Ypd1 And Sln1 Response Regulator Domain
          In Space Group P3(2)
 pdb|1OXK|F Chain F, Complex Between Ypd1 And Sln1 Response Regulator Domain
          In Space Group P3(2)
 pdb|1OXK|H Chain H, Complex Between Ypd1 And Sln1 Response Regulator Domain
          In Space Group P3(2)
 pdb|1OXK|J Chain J, Complex Between Ypd1 And Sln1 Response Regulator Domain
          In Space Group P3(2)
 pdb|1OXK|L Chain L, Complex Between Ypd1 And Sln1 Response Regulator Domain
          In Space Group P3(2)
          Length = 134

 Score = 26.2 bits (56), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 9/31 (29%), Positives = 20/31 (64%)

Query: 3  DSFVDRKVIERLLTISSSRDLYCSCSGRRAL 33
          D+ V+++VI+R+L +    ++  +C G+ A 
Sbjct: 9  DNHVNQEVIKRMLNLEGIENIELACDGQEAF 39


>pdb|2R25|B Chain B, Complex Of Ypd1 And Sln1-R1 With Bound Mg2+ And Bef3-
          Length = 133

 Score = 26.2 bits (56), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 9/31 (29%), Positives = 20/31 (64%)

Query: 3  DSFVDRKVIERLLTISSSRDLYCSCSGRRAL 33
          D+ V+++VI+R+L +    ++  +C G+ A 
Sbjct: 10 DNHVNQEVIKRMLNLEGIENIELACDGQEAF 40


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.138    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,587,189
Number of Sequences: 62578
Number of extensions: 87039
Number of successful extensions: 130
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 128
Number of HSP's gapped (non-prelim): 2
length of query: 93
length of database: 14,973,337
effective HSP length: 60
effective length of query: 33
effective length of database: 11,218,657
effective search space: 370215681
effective search space used: 370215681
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)