Citrus Sinensis ID: 043012

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-

MVLRNKILLDLKPAQLAAVCASLVSEGIKVRLWKNNSYIYEPSTTVINVINVLDEHRSSFLELQEKHGVEIPCCLDSQFSGMVEAWASGLTWREMMMDCALDDGDLARLLRRTIDLLAQIPKLPDVDQRLQKNAVDASNVMDRPPISELAG

ccccccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccc

MVLRNKILLDLKPAQLAAVCASLVSEGIKVRLWKNNSYIYEPSTTVINVINVLDEHRSSFLELQEKHGVEIPCCLDSQFSGMVEAWASGLTWREMMMDCALDDGDLARLLRRTIDLLAQIPKLPDVDQRLQKNAVDASNVMDRPPISEL*G

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVLRNKILLDLKPAQLAAVCASLVSEGIKVRLWKNNSYIYEPSTTVINVINVLDEHRSSFLELQEKHGVEIPCCLDSQFSGMVEAWASGLTWREMMMDCALDDGDLARLLRRTIDLLAQIPKLPDVDQRLQKNAVDASNVMDRPPISELAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DEAD-box ATP-dependent RNA helicase ISE2, chloroplastic	Essential protein required during embryogenesis. Involved in post-transcriptional gene silencing. Modulates the determination of cell fate. Necessary for normal plasmodesmata (PD) development and aperture regulation.	probable	B9DFG3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A4Z, chain A
Confidence level:very confident
Coverage over the Query: 2-149
View the alignment between query and template
View the model in PyMOL