BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043014
         (173 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SGH|A Chain A, Crystal Structure Of A Hypothetical Susd-Like Protein
          (Bt_3752) From Bacteroides Thetaiotaomicron Vpi-5482 At
          1.70 A Resolution
 pdb|3SGH|B Chain B, Crystal Structure Of A Hypothetical Susd-Like Protein
          (Bt_3752) From Bacteroides Thetaiotaomicron Vpi-5482 At
          1.70 A Resolution
          Length = 499

 Score = 26.6 bits (57), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 48 ILLSSSWNFLKSILSWYNLQSHQNPSSGWPALYA 81
          +  +++W+F K+I ++YN     N SS W  LY 
Sbjct: 50 VTATANWSFGKNIFAYYNASEGHNDSS-WGRLYG 82


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.141    0.456 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,515,347
Number of Sequences: 62578
Number of extensions: 98530
Number of successful extensions: 238
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 236
Number of HSP's gapped (non-prelim): 3
length of query: 173
length of database: 14,973,337
effective HSP length: 92
effective length of query: 81
effective length of database: 9,216,161
effective search space: 746509041
effective search space used: 746509041
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 48 (23.1 bits)