Query         043057
Match_columns 236
No_of_seqs    122 out of 190
Neff          5.4 
Searched_HMMs 46136
Date          Fri Mar 29 12:24:29 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/043057.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/043057hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG5192 BMS1 GTP-binding prote  99.1 2.8E-11 6.1E-16  118.8   4.4  148   74-231   473-661 (1077)
  2 COG3529 Predicted nucleic-acid  17.0      50  0.0011   24.1   0.2   12  146-157     2-13  (66)
  3 PF14983 DUF4513:  Domain of un   8.4 1.2E+02  0.0025   24.9  -0.1   23   79-104    48-72  (132)
  4 PF04633 Herpes_BMRF2:  Herpesv   6.2 2.2E+02  0.0047   27.4   0.5   20   28-47    173-192 (349)
  5 COG5515 Uncharacterized conser   6.1 1.8E+02  0.0039   21.3  -0.0    8  149-156     6-13  (70)
  6 TIGR02443 conserved hypothetic   5.5 1.7E+02  0.0038   21.0  -0.4   10  147-156     2-11  (59)
  7 PF09526 DUF2387:  Probable met   5.4 1.7E+02  0.0036   21.6  -0.6   10  147-156     1-10  (71)
  8 smart00153 VHP Villin headpiec   5.0 2.3E+02  0.0051   18.1  -0.0   16   78-94     20-35  (36)
  9 PF02209 VHP:  Villin headpiece   4.9 2.1E+02  0.0046   18.4  -0.3   15   79-94     21-35  (36)
 10 KOG3448 Predicted snRNP core p   4.2 1.8E+02  0.0038   22.8  -1.2   10  146-155    56-65  (96)

No 1  
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis]
Probab=99.14  E-value=2.8e-11  Score=118.81  Aligned_cols=148  Identities=20%  Similarity=0.277  Sum_probs=89.2

Q ss_pred             CCCCchhhhhccchhhhcccccc-ccc---cc-ccCCCCCccccc--c-cccCCC---CCCCCCCCCCCcccCCCCCch-
Q 043057           74 DDNDTVDNQLSSGTEEREDNDDA-RIS---FS-LYTGNQHQHQKL--S-KEVHDS---SKGEENDDDEFFKPKVKGNKE-  141 (236)
Q Consensus        74 dd~~~~~kWKenl~a~ra~~~~~-rr~---~k-IY~~~~~p~~~~--~-~ed~~~---~~~e~~ddddFFk~k~~~~~~-  141 (236)
                      ++.++-.+||+.| |.+++.+.+ +|.   .+ ||+.+++|.+|+  | |++..+   +.+..++.++||++....+.. 
T Consensus       473 dese~~~~w~~~~-a~kl~~sqs~kr~~ni~ki~y~e~lspeeci~e~kge~~~s~e~~~v~~D~~edff~vsk~~n~~~  551 (1077)
T COG5192         473 DESEGNLRWKEGL-ASKLAYSQSGKRGRNIQKIFYDESLSPEECIEEYKGESAKSSESDLVVQDEPEDFFDVSKVANESI  551 (1077)
T ss_pred             ccccccchhhhhh-hhhhhhhhcccccccccceeccccCCHHHHHHHhccccccccccccccccCchhhhhhhhhccccc
Confidence            3346778999999 999886554 332   78 999999999999  8 776222   234445667899954333222 


Q ss_pred             -------------------HHHHHHhhhhccCCcchhhh-hhhccCCCCCCCCCcccccCCCccccccccccCCC-CCCC
Q 043057          142 -------------------EAYESIRDRFVMGDWSKAAQ-KNQVSKGKSEDDDSDDAVYGDYEDLETCEKHEGQC-EDNS  200 (236)
Q Consensus       142 -------------------e~~dsIR~rFVTG~w~~~~~-~~~~~~~~~~~eddddE~~GDFEDLEtGE~~~~~~-~~~~  200 (236)
                                         ..+..|+.||+++....... ...+         -.+...|+||||+..+...... ++..
T Consensus       552 s~~~ek~~~~~fe~L~kkw~s~~~lk~RF~~~~~lds~eg~EEl---------~qd~E~gn~ed~~d~e~~~d~e~ees~  622 (1077)
T COG5192         552 SSNHEKLMESEFEELKKKWSSLAQLKSRFQKDATLDSIEGEEEL---------IQDDEKGNFEDLEDEENSSDNEMEESR  622 (1077)
T ss_pred             ccchhhhchhHHHHHHHHHhhHHHHHHHhhcccccccccchhhh---------hhchhccCcccccccccccccchhhcc
Confidence                               66889999999987653211 0011         0122358999999766543211 1111


Q ss_pred             CC----CCCCCcchhHHHHHHH----HHHHHHHhhhhcC
Q 043057          201 GS----EGIENEDESAVEEWRL----KKLTLRAKFDAQY  231 (236)
Q Consensus       201 ~~----~~~~~~de~~~e~e~~----KkekLK~kFeee~  231 (236)
                      ++    ...+..++-+++.+++    ||++|+.+|+.+.
T Consensus       623 G~s~t~~~~e~~~e~~~e~ErE~na~kKE~lr~~Fe~ee  661 (1077)
T COG5192         623 GSSVTAENEESADEVDYETEREENARKKEELRGNFELEE  661 (1077)
T ss_pred             CCcccccchhhccccchHHHhhhhhhhhhhhhcceeehh
Confidence            10    0011112223443333    5799999998776


No 2  
>COG3529 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=17.01  E-value=50  Score=24.06  Aligned_cols=12  Identities=42%  Similarity=0.783  Sum_probs=9.6

Q ss_pred             HHhhhhccCCcc
Q 043057          146 SIRDRFVMGDWS  157 (236)
Q Consensus       146 sIR~rFVTG~w~  157 (236)
                      +||.|||.|..-
T Consensus         2 ~~rKRFIAGA~C   13 (66)
T COG3529           2 AIRKRFIAGAVC   13 (66)
T ss_pred             chhhhhhccCCC
Confidence            579999999643


No 3  
>PF14983 DUF4513:  Domain of unknown function (DUF4513)
Probab=8.38  E-value=1.2e+02  Score=24.92  Aligned_cols=23  Identities=22%  Similarity=0.117  Sum_probs=14.3

Q ss_pred             hhhhhccchhhhccccccccc-cc-ccC
Q 043057           79 VDNQLSSGTEEREDNDDARIS-FS-LYT  104 (236)
Q Consensus        79 ~~kWKenl~a~ra~~~~~rr~-~k-IY~  104 (236)
                      ++.||++| .-|...+  +.. +- ||-
T Consensus        48 VmpWK~dM-kfR~~nl--K~ae~~GIy~   72 (132)
T PF14983_consen   48 VMPWKEDM-KFRNVNL--KNAELCGIYT   72 (132)
T ss_pred             cCchhhhh-hhhHHhh--hhhhhccccc
Confidence            56799999 6555421  222 66 884


No 4  
>PF04633 Herpes_BMRF2:  Herpesvirus BMRF2 protein;  InterPro: IPR006727   This is a family of unknown function found in the Herpes viruses.
Probab=6.19  E-value=2.2e+02  Score=27.38  Aligned_cols=20  Identities=30%  Similarity=0.459  Sum_probs=17.7

Q ss_pred             hhhHHHhhhchhhhhhhhcc
Q 043057           28 DNFVEYVEFNEVQHRRRAIF   47 (236)
Q Consensus        28 ~~~~~~~e~~~gr~rr~a~F   47 (236)
                      .|++++.-+..|-+|||+||
T Consensus       173 ~~~~~~~~y~~gl~rrrsIf  192 (349)
T PF04633_consen  173 RHFRRHPIYESGLERRRSIF  192 (349)
T ss_pred             HHHHhCHHHHHHHHhccceE
Confidence            57888888889999999998


No 5  
>COG5515 Uncharacterized conserved small protein [Function unknown]
Probab=6.11  E-value=1.8e+02  Score=21.30  Aligned_cols=8  Identities=38%  Similarity=0.505  Sum_probs=6.1

Q ss_pred             hhhccCCc
Q 043057          149 DRFVMGDW  156 (236)
Q Consensus       149 ~rFVTG~w  156 (236)
                      =|||||+=
T Consensus         6 YRfiTGpD   13 (70)
T COG5515           6 YRFITGPD   13 (70)
T ss_pred             eEeecCCc
Confidence            37999974


No 6  
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=5.52  E-value=1.7e+02  Score=21.02  Aligned_cols=10  Identities=40%  Similarity=0.833  Sum_probs=7.7

Q ss_pred             HhhhhccCCc
Q 043057          147 IRDRFVMGDW  156 (236)
Q Consensus       147 IR~rFVTG~w  156 (236)
                      +|.|||.|-.
T Consensus         2 ~kKRFIAGA~   11 (59)
T TIGR02443         2 IKKRFIAGAV   11 (59)
T ss_pred             ccceEecccc
Confidence            5789999853


No 7  
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=5.37  E-value=1.7e+02  Score=21.59  Aligned_cols=10  Identities=30%  Similarity=0.783  Sum_probs=7.4

Q ss_pred             HhhhhccCCc
Q 043057          147 IRDRFVMGDW  156 (236)
Q Consensus       147 IR~rFVTG~w  156 (236)
                      +|.|||.|-.
T Consensus         1 ~kkrFIAGa~   10 (71)
T PF09526_consen    1 MKKRFIAGAV   10 (71)
T ss_pred             CCceEecCcc
Confidence            4789999853


No 8  
>smart00153 VHP Villin headpiece domain.
Probab=5.03  E-value=2.3e+02  Score=18.11  Aligned_cols=16  Identities=0%  Similarity=-0.242  Sum_probs=10.3

Q ss_pred             chhhhhccchhhhcccc
Q 043057           78 TVDNQLSSGTEEREDND   94 (236)
Q Consensus        78 ~~~kWKenl~a~ra~~~   94 (236)
                      ..|.||++- ..+...+
T Consensus        20 ~LP~WKq~~-lKk~~~L   35 (36)
T smart00153       20 KLPLWKQNQ-LKKKLGL   35 (36)
T ss_pred             hCcHhhHHH-HHhhcCC
Confidence            357898877 6665543


No 9  
>PF02209 VHP:  Villin headpiece domain;  InterPro: IPR003128 Villin is an F-actin bundling protein involved in the maintenance of the microvilli of the absorptive epithelia. The villin-type "headpiece" domain is a modular motif found at the extreme C terminus of larger "core" domains in over 25 cytoskeletal proteins in plants and animals, often in assocation with the Gelsolin repeat. Although the headpiece is classified as an F-actin-binding domain, it has been shown that not all headpiece domains are intrinsically F-actin-binding motifs, surface charge distribution may be an important element for F-actin recognition []. An autonomously folding, 35 residue, thermostable subdomain (HP36) of the full-length 76 amino acid residue villin headpiece, is the smallest known example of a cooperatively folded domain of a naturally occurring protein. The structure of HP36, as determined by NMR spectroscopy, consists of three short helices surrounding a tightly packed hydrophobic core []. ; GO: 0003779 actin binding, 0007010 cytoskeleton organization; PDB: 1ZV6_A 1QZP_A 1UND_A 2PPZ_A 3TJW_B 1YU8_X 2JM0_A 1WY4_A 3MYC_A 1YU5_X ....
Probab=4.87  E-value=2.1e+02  Score=18.38  Aligned_cols=15  Identities=0%  Similarity=-0.064  Sum_probs=9.0

Q ss_pred             hhhhhccchhhhcccc
Q 043057           79 VDNQLSSGTEEREDND   94 (236)
Q Consensus        79 ~~kWKenl~a~ra~~~   94 (236)
                      -|.||++- ..+..++
T Consensus        21 lP~WKq~~-lKK~~~L   35 (36)
T PF02209_consen   21 LPKWKQNN-LKKKAGL   35 (36)
T ss_dssp             S-HHHHHH-HHHHTTT
T ss_pred             ChHHHHHH-HHHHhCC
Confidence            47898877 5655443


No 10 
>KOG3448 consensus Predicted snRNP core protein [RNA processing and modification]
Probab=4.21  E-value=1.8e+02  Score=22.77  Aligned_cols=10  Identities=30%  Similarity=0.783  Sum_probs=0.0

Q ss_pred             HHhhhhccCC
Q 043057          146 SIRDRFVMGD  155 (236)
Q Consensus       146 sIR~rFVTG~  155 (236)
                      ++|+|||.|.
T Consensus        56 Sv~ncfIRGS   65 (96)
T KOG3448|consen   56 SVKNCFIRGS   65 (96)
T ss_pred             eeeeEEEecc


Done!