BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043105
         (426 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CWV|A Chain A, Crystal Structure Of B-Subunit Of The Dna Gyrase From
           Myxococcus Xanthus
 pdb|3CWV|B Chain B, Crystal Structure Of B-Subunit Of The Dna Gyrase From
           Myxococcus Xanthus
          Length = 369

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 38  SSQTKTFANVFIAIVGAGVLGLPYAFKRTGWLMGSLMIISVSALTFHCMMLLVHTRRKLE 97
           +S+T T  N+     GAG LG P      GW   S++++S++  + + + +    R+   
Sbjct: 69  TSRTVTAENLVRVATGAGFLGRPPG---DGWGWDSMLVVSLALSSRYQVDIWADGRQWRV 125

Query: 98  SSEHGFTK 105
             EHG  +
Sbjct: 126 MGEHGHPQ 133


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.144    0.447 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,919,434
Number of Sequences: 62578
Number of extensions: 412556
Number of successful extensions: 856
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 856
Number of HSP's gapped (non-prelim): 3
length of query: 426
length of database: 14,973,337
effective HSP length: 102
effective length of query: 324
effective length of database: 8,590,381
effective search space: 2783283444
effective search space used: 2783283444
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 53 (25.0 bits)