BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043130
         (157 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IT0|A Chain A, Crystal Structure Francisella Tularensis Histidine Acid
           Phosphatase Complexed With Phosphate
 pdb|3IT0|B Chain B, Crystal Structure Francisella Tularensis Histidine Acid
           Phosphatase Complexed With Phosphate
 pdb|3IT1|A Chain A, Crystal Structure Francisella Tularensis Histidine Acid
           Phosphatase Complexed With L(+)-Tartrate
 pdb|3IT1|B Chain B, Crystal Structure Francisella Tularensis Histidine Acid
           Phosphatase Complexed With L(+)-Tartrate
 pdb|3IT2|A Chain A, Crystal Structure Of Ligand-Free Francisella Tularensis
           Histidine Acid Phosphatase
 pdb|3IT2|B Chain B, Crystal Structure Of Ligand-Free Francisella Tularensis
           Histidine Acid Phosphatase
          Length = 342

 Score = 26.2 bits (56), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 88  EWEKKYYTGYDSYICEAMGVLQAQLMNTRPSFA 120
           +++  YY+G+D  + E MG L   L +T P +A
Sbjct: 251 KYKMTYYSGHDLTLLEVMGTLGVPL-DTAPGYA 282


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.135    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,367,164
Number of Sequences: 62578
Number of extensions: 169259
Number of successful extensions: 347
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 346
Number of HSP's gapped (non-prelim): 3
length of query: 157
length of database: 14,973,337
effective HSP length: 91
effective length of query: 66
effective length of database: 9,278,739
effective search space: 612396774
effective search space used: 612396774
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)