BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 043133
(131 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2H6R|A Chain A, Crystal Structure Of Triosephosphate Isomerase (Tim) From
Methanocaldococcus Jannaschii
pdb|2H6R|B Chain B, Crystal Structure Of Triosephosphate Isomerase (Tim) From
Methanocaldococcus Jannaschii
pdb|2H6R|C Chain C, Crystal Structure Of Triosephosphate Isomerase (Tim) From
Methanocaldococcus Jannaschii
pdb|2H6R|D Chain D, Crystal Structure Of Triosephosphate Isomerase (Tim) From
Methanocaldococcus Jannaschii
pdb|2H6R|E Chain E, Crystal Structure Of Triosephosphate Isomerase (Tim) From
Methanocaldococcus Jannaschii
pdb|2H6R|F Chain F, Crystal Structure Of Triosephosphate Isomerase (Tim) From
Methanocaldococcus Jannaschii
pdb|2H6R|G Chain G, Crystal Structure Of Triosephosphate Isomerase (Tim) From
Methanocaldococcus Jannaschii
pdb|2H6R|H Chain H, Crystal Structure Of Triosephosphate Isomerase (Tim) From
Methanocaldococcus Jannaschii
Length = 219
Score = 25.4 bits (54), Expect = 8.2, Method: Compositional matrix adjust.
Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 1/54 (1%)
Query: 2 CKSILKDITERRSLSISINQFRNYCKNLDAHC-SCSYDFPQGQEILTLEKQCHA 54
CK L + +E+R L I N CKNL C+ + + + L C A
Sbjct: 83 CKGTLINHSEKRMLLADIEAVINKCKNLGLETIVCTNNINTSKAVAALSPDCIA 136
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.138 0.419
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,077,222
Number of Sequences: 62578
Number of extensions: 91703
Number of successful extensions: 256
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 255
Number of HSP's gapped (non-prelim): 3
length of query: 131
length of database: 14,973,337
effective HSP length: 88
effective length of query: 43
effective length of database: 9,466,473
effective search space: 407058339
effective search space used: 407058339
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 46 (22.3 bits)