BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043142
         (512 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk
           Docking Peptide
          Length = 362

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 5/45 (11%)

Query: 189 CGLVKVARNLFEQLREKRVVSWNAMITGYAMHGHSTKALDLFEKM 233
           CG+   ARN    L  K  V WN +          +KALDL +KM
Sbjct: 256 CGINLKARNYLLSLPHKNKVPWNRLFP-----NADSKALDLLDKM 295


>pdb|1ITQ|A Chain A, Human Renal Dipeptidase
 pdb|1ITQ|B Chain B, Human Renal Dipeptidase
 pdb|1ITU|A Chain A, Human Renal Dipeptidase Complexed With Cilastatin
 pdb|1ITU|B Chain B, Human Renal Dipeptidase Complexed With Cilastatin
          Length = 369

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 24/58 (41%)

Query: 77  PFALKACSALSAIEEGRRIHEDVIRNKWETDVFVGAALIDMYAKCSCVVNARQVFDKI 134
           P      SA S     R + +DV+R   +TD  V     + Y  C+   N  QV D +
Sbjct: 214 PVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHL 271


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.139    0.443 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,643,071
Number of Sequences: 62578
Number of extensions: 625242
Number of successful extensions: 1737
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1736
Number of HSP's gapped (non-prelim): 2
length of query: 512
length of database: 14,973,337
effective HSP length: 103
effective length of query: 409
effective length of database: 8,527,803
effective search space: 3487871427
effective search space used: 3487871427
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)