Citrus Sinensis ID: 043163


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
SDYVVILAALLCALICVLGLIAVARCAWLRRLSGGGAAATNPSGTSTRNSPANKGLKKKILRTLPKQTFTSESVAKFSDCAICLTEFVNGDEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVVARCQKCGGFPASSSSSSGAGVEGGAAETSEARSEEKQDDPNRFLP
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHcccEEECcccccccccccEEccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
SDYVVILAALLCALICVLGLIAVARCAWLRRL****************************LRTLPKQTFTSESVAKFSDCAICLTEFVNGDEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVV*********************************************
xxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SDYVVILAALLCALICVLGLIAVARCAWLRRLSGGGAAATNPSGTSTRNSPANKGLKKKILRTLPKQTFTSESVAKFSDCAICLTEFVNGDEIRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVVARCQKCGGFPASSSSSSGAGVEGGAAETSEARSEEKQDDPNRFLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RING-H2 finger protein ATL80 May be involved in the early steps of the plant defense signaling pathway.probableQ9LM69

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 47-127
View the alignment between query and template
View the model in PyMOL
Template: 2L8S, chain A
Confidence level:probable
Coverage over the Query: 4-33
View the alignment between query and template
View the model in PyMOL