Query         043175
Match_columns 139
No_of_seqs    113 out of 857
Neff          7.6 
Searched_HMMs 46136
Date          Fri Mar 29 13:39:23 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/043175.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/043175hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 2.1E-49 4.5E-54  279.2   7.4  127    3-132     1-129 (129)
  2 PHA00692 hypothetical protein   70.5     1.6 3.4E-05   26.6   0.2    9    2-10     36-44  (74)
  3 cd00490 Met_repressor_MetJ Met  57.9      11 0.00023   24.9   2.3   39   10-52     50-88  (103)
  4 PRK05264 transcriptional repre  53.4      12 0.00027   24.8   2.1   39   10-52     51-89  (105)
  5 KOG3238 Chloride ion current i  50.8      16 0.00035   27.7   2.6   59    4-62    110-168 (216)
  6 PF07960 CBP4:  CBP4;  InterPro  47.9      10 0.00022   26.7   1.1   11   10-20     30-40  (128)
  7 smart00265 BH4 BH4 Bcl-2 homol  45.8      28 0.00061   17.7   2.3   21   11-31      3-23  (27)
  8 COG3060 MetJ Transcriptional r  43.9      15 0.00032   24.1   1.4   39   10-52     51-89  (105)
  9 PF01340 MetJ:  Met Apo-repress  43.7      16 0.00035   24.2   1.5   39   10-52     50-88  (104)
 10 PF13822 ACC_epsilon:  Acyl-CoA  41.7      14 0.00031   22.4   1.0    9   10-18     10-18  (62)
 11 smart00707 RPEL Repeat in Dros  39.2      22 0.00049   17.9   1.3   13    6-18      6-18  (26)
 12 cd00954 NAL N-Acetylneuraminic  37.1      19 0.00041   28.2   1.3   19    3-22    103-121 (288)
 13 PLN02417 dihydrodipicolinate s  36.7      20 0.00043   28.0   1.4   18    3-21    103-120 (280)
 14 TIGR02313 HpaI-NOT-DapA 2,4-di  35.5      22 0.00048   28.0   1.5   19    3-22    102-120 (294)
 15 cd00952 CHBPH_aldolase Trans-o  34.4      22 0.00049   28.2   1.3   18    2-20    109-126 (309)
 16 PF08338 DUF1731:  Domain of un  34.2      31 0.00067   19.8   1.6   16    5-20     31-47  (48)
 17 PF01473 CW_binding_1:  Putativ  31.7      38 0.00082   15.2   1.4    8   58-65      7-14  (19)
 18 cd00950 DHDPS Dihydrodipicolin  31.4      29 0.00062   27.0   1.4   28    2-31    101-128 (284)
 19 TIGR00674 dapA dihydrodipicoli  29.7      35 0.00077   26.6   1.7   19    3-22    100-118 (285)
 20 PRK03170 dihydrodipicolinate s  29.3      34 0.00073   26.8   1.5   27    3-31    103-129 (292)
 21 PRK04147 N-acetylneuraminate l  26.8      37  0.0008   26.6   1.4   27    3-31    106-132 (293)
 22 PF07131 DUF1382:  Protein of u  26.5      47   0.001   20.2   1.5   14    5-18     22-39  (61)
 23 PF09174 Maf1:  Maf1 regulator;  24.0      18 0.00039   26.7  -0.9   13   35-47    137-149 (179)
 24 PF12672 DUF3793:  Protein of u  23.4      53  0.0011   24.1   1.6   39    6-50     83-122 (176)
 25 TIGR03249 KdgD 5-dehydro-4-deo  23.3      50  0.0011   26.0   1.5   27    3-31    106-132 (296)
 26 PF02755 RPEL:  RPEL repeat;  I  22.9      51  0.0011   16.5   1.0   10    9-18      9-18  (26)
 27 COG2326 Uncharacterized conser  22.7      76  0.0016   25.1   2.3   28    4-31    100-131 (270)
 28 PF02180 BH4:  Bcl-2 homology r  22.4      80  0.0017   16.1   1.6   19   12-30      4-22  (27)
 29 PRK14390 hypothetical protein;  22.3      39 0.00084   20.8   0.5   43    3-48     13-55  (63)
 30 cd00408 DHDPS-like Dihydrodipi  22.0      55  0.0012   25.2   1.5   27    3-31     99-125 (281)
 31 PF02375 JmjN:  jmjN domain;  I  22.0      45 0.00097   17.8   0.7   11    8-18      2-12  (34)
 32 PRK03620 5-dehydro-4-deoxygluc  21.6      52  0.0011   26.0   1.3   27    3-31    108-134 (303)
 33 COG4802 FtrB Ferredoxin-thiore  20.1      85  0.0018   21.3   1.9   31    5-36     20-56  (110)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=2.1e-49  Score=279.16  Aligned_cols=127  Identities=34%  Similarity=0.610  Sum_probs=96.6

Q ss_pred             CCCceeEcCChHHHHHHHHhHhcCCCCCCC-CeeeecCCCCCCCcCccccCccCCCCceEEEEeccccccCCCCcceeec
Q 043175            3 SLMGFRFQPSNEQIFCLLEKKRLNPHFSHH-TIKDIDDICGLEPWDLAGASKTESEDRVCYFFCKPCYKYKKSTRAHRRT   81 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~~k~~g~~~~~-~~I~~~Dvy~~~P~~L~~~~~~~~~~~~~yFF~~~~~~~~~~~r~~R~~   81 (139)
                      |||||||+|||+|||.+||++|+.|.+++. ++|+++|||++|||+|+...  .+++.+||||+++++++.+++|.+|++
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~~~--~~~~~~~yFF~~~~~~~~~~~r~~R~~   78 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPAKF--KGGDEEWYFFSPRKKKYPNGGRPNRVT   78 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHHHS--SS-SSEEEEEEE----------S-EEE
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhhhc--cCCCceEEEEEecccccCCcccccccc
Confidence            899999999999999999999999999887 89999999999999999432  336779999999999999999999999


Q ss_pred             ccceeEecCCCeEEec-CCceEeeeEEEEEEeeCCCCCCCCcCeEEEEEEeC
Q 043175           82 NAGYWKVTGRGSKIKT-RNGLSGTKKILTFQYHGPASKKAKIGWVMHEYHVN  132 (139)
Q Consensus        82 ~~G~W~~~g~~~~i~~-~~~~~G~k~~l~f~~~~~~~~~~kt~W~M~EY~l~  132 (139)
                      ++|+||++|+.++|.+ ++.++|+|++|+| |.++.+++.+|+|+||||+|.
T Consensus        79 ~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f-~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   79 GGGYWKSTGKEKPIKDPGGKVIGFKKTLVF-YSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             TTEEEEEECEEEEEEE-TTCEEEEEEEEEE-EESSTTS-EEEEEEEEEEEE-
T ss_pred             cceEEeecccccccccccceeeeeEEEEEE-EeccCCCCCcCCeEEEEEEeC
Confidence            9999999999999998 7799999999999 888778889999999999984


No 2  
>PHA00692 hypothetical protein
Probab=70.48  E-value=1.6  Score=26.62  Aligned_cols=9  Identities=56%  Similarity=0.788  Sum_probs=7.8

Q ss_pred             CCCCceeEc
Q 043175            2 ESLMGFRFQ   10 (139)
Q Consensus         2 ~lp~G~rF~   10 (139)
                      +.||||||-
T Consensus        36 eyppgfrfg   44 (74)
T PHA00692         36 EYPPGFRFG   44 (74)
T ss_pred             ecCCCcccc
Confidence            679999996


No 3  
>cd00490 Met_repressor_MetJ Met Repressor, MetJ.  MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine.  MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence.  MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Probab=57.87  E-value=11  Score=24.94  Aligned_cols=39  Identities=10%  Similarity=0.104  Sum_probs=31.7

Q ss_pred             cCChHHHHHHHHhHhcCCCCCCCCeeeecCCCCCCCcCccccC
Q 043175           10 QPSNEQIFCLLEKKRLNPHFSHHTIKDIDDICGLEPWDLAGAS   52 (139)
Q Consensus        10 ~PtDeELi~~yL~~k~~g~~~~~~~I~~~Dvy~~~P~~L~~~~   52 (139)
                      |-|..||++.-...-..|+|+|.    +.|+-...|.+||...
T Consensus        50 HATNSELLCEAFLHAfTGQPLP~----D~Dl~K~~~d~iP~~a   88 (103)
T cd00490          50 HATNSELLCEAFLHAFTGQPLPD----DADLRKERSDEIPEAA   88 (103)
T ss_pred             hcccHHHHHHHHHHHhcCCCCCC----hhhhhhcCcccccHHH
Confidence            35677888877777899999996    6788888999998764


No 4  
>PRK05264 transcriptional repressor protein MetJ; Provisional
Probab=53.45  E-value=12  Score=24.76  Aligned_cols=39  Identities=10%  Similarity=0.130  Sum_probs=31.4

Q ss_pred             cCChHHHHHHHHhHhcCCCCCCCCeeeecCCCCCCCcCccccC
Q 043175           10 QPSNEQIFCLLEKKRLNPHFSHHTIKDIDDICGLEPWDLAGAS   52 (139)
Q Consensus        10 ~PtDeELi~~yL~~k~~g~~~~~~~I~~~Dvy~~~P~~L~~~~   52 (139)
                      |-|..||++.-...-..|+|+|.    +.|+-...|..+|...
T Consensus        51 HATNSELLCEAFLHA~TGQPLP~----D~Dl~Kd~~d~ip~~a   89 (105)
T PRK05264         51 HATNSELLCEAFLHAFTGQPLPD----DEDLRKERSDEIPEAA   89 (105)
T ss_pred             hcccHHHHHHHHHHHHcCCCCCC----hhhhhhcCcccchHHH
Confidence            35677888877777899999996    6788888899998654


No 5  
>KOG3238 consensus Chloride ion current inducer protein [Inorganic ion transport and metabolism]
Probab=50.75  E-value=16  Score=27.71  Aligned_cols=59  Identities=15%  Similarity=0.211  Sum_probs=33.8

Q ss_pred             CCceeEcCChHHHHHHHHhHhcCCCCCCCCeeeecCCCCCCCcCccccCccCCCCceEE
Q 043175            4 LMGFRFQPSNEQIFCLLEKKRLNPHFSHHTIKDIDDICGLEPWDLAGASKTESEDRVCY   62 (139)
Q Consensus         4 p~G~rF~PtDeELi~~yL~~k~~g~~~~~~~I~~~Dvy~~~P~~L~~~~~~~~~~~~~y   62 (139)
                      --+|||+|+|..-+.-.--.....+.+......+.+-|.-+=|+.-......++...||
T Consensus       110 i~e~rfvpsDk~~l~a~f~qfcecqel~p~P~ED~~~~dgee~~mea~d~~~gDs~~~~  168 (216)
T KOG3238|consen  110 ITEFRFVPSDKSALEAMFTQFCECQELNPDPDEDEDDYDGEEYDMEAHDAGQGDSPNSY  168 (216)
T ss_pred             cccceecCCchhHHHHHHHHHHhhhhcCCCccccccccccchhhhhhhhccCCCCcccc
Confidence            35799999998877654444444444433335666667666666654432233333333


No 6  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=47.88  E-value=10  Score=26.69  Aligned_cols=11  Identities=27%  Similarity=0.609  Sum_probs=9.5

Q ss_pred             cCChHHHHHHH
Q 043175           10 QPSNEQIFCLL   20 (139)
Q Consensus        10 ~PtDeELi~~y   20 (139)
                      .||||||+..|
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            49999999875


No 7  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=45.75  E-value=28  Score=17.74  Aligned_cols=21  Identities=10%  Similarity=0.018  Sum_probs=16.4

Q ss_pred             CChHHHHHHHHhHhcCCCCCC
Q 043175           11 PSNEQIFCLLEKKRLNPHFSH   31 (139)
Q Consensus        11 PtDeELi~~yL~~k~~g~~~~   31 (139)
                      .+-.|||.+|+.-|+...-.+
T Consensus         3 ~~nRelV~~yv~yKLsQrgy~   23 (27)
T smart00265        3 LDNRELVVDYVTYKLSQNGYE   23 (27)
T ss_pred             cchHHHHHHHHHHHHhhcCCC
Confidence            356899999999998865543


No 8  
>COG3060 MetJ Transcriptional regulator of met regulon [Transcription / Amino acid transport and metabolism]
Probab=43.94  E-value=15  Score=24.09  Aligned_cols=39  Identities=10%  Similarity=0.098  Sum_probs=31.2

Q ss_pred             cCChHHHHHHHHhHhcCCCCCCCCeeeecCCCCCCCcCccccC
Q 043175           10 QPSNEQIFCLLEKKRLNPHFSHHTIKDIDDICGLEPWDLAGAS   52 (139)
Q Consensus        10 ~PtDeELi~~yL~~k~~g~~~~~~~I~~~Dvy~~~P~~L~~~~   52 (139)
                      +-|..||++.-...-..|+|+|.    +.|+....|.+||+..
T Consensus        51 hatnsellceaflhaftgqplpt----d~dl~ker~deipe~a   89 (105)
T COG3060          51 HATNSELLCEAFLHAFTGQPLPT----DADLRKERSDEIPEAA   89 (105)
T ss_pred             hhhhHHHHHHHHHHHHcCCCCCC----cHHHHHhccccchHHH
Confidence            35677888877777889999985    7888888889998764


No 9  
>PF01340 MetJ:  Met Apo-repressor, MetJ;  InterPro: IPR002084 Binding of a specific DNA fragment and S-adenosyl methionine (SAM) co-repressor molecules to the Escherichia coli methionine repressor (MetJ) leads to a significant reduction in dynamic flexibility of the ternary complex, with considerable entropy-enthalpy compensation, not necessarily involving any overall conformational change []. MetJ is a regulatory protein which when combined with S-adenosylmethionine (SAM) represses the expression of the methionine regulon and of enzymes involved in SAM synthesis. It is also autoregulated. The crystal structure of the met repressor-operator complex shows two dimeric repressor molecules bound to adjacent sites 8 base pairs apart on an 18-base-pair DNA fragment. Sequence specificity is achieved by insertion of double-stranded antiparallel protein beta-ribbons into the major groove of B-form DNA, with direct hydrogen-bonding between amino-acid side chains and the base pairs. The repressor also recognises sequence-dependent distortion or flexibility of the operator phosphate backbone, conferring specificity even for inaccessible base pairs [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0006555 methionine metabolic process; PDB: 1MJO_D 1CMB_A 1MJQ_C 1CMC_B 1MJK_A 1MJ2_A 1MJP_A 1MJM_B 1CMA_B 1MJL_A ....
Probab=43.68  E-value=16  Score=24.15  Aligned_cols=39  Identities=13%  Similarity=0.182  Sum_probs=24.6

Q ss_pred             cCChHHHHHHHHhHhcCCCCCCCCeeeecCCCCCCCcCccccC
Q 043175           10 QPSNEQIFCLLEKKRLNPHFSHHTIKDIDDICGLEPWDLAGAS   52 (139)
Q Consensus        10 ~PtDeELi~~yL~~k~~g~~~~~~~I~~~Dvy~~~P~~L~~~~   52 (139)
                      |-|..||++.-...-..|+|+|.    +.|+-...|..+|...
T Consensus        50 HATNSeLLcEAFLHAfTGQPLP~----D~dl~kd~~d~ip~~~   88 (104)
T PF01340_consen   50 HATNSELLCEAFLHAFTGQPLPT----DDDLRKDRPDEIPAEA   88 (104)
T ss_dssp             S-SHHHHHHHHHHHHHH----------TTGGGSTSGSSS-HHH
T ss_pred             hcccHHHHHHHHHHHhcCCCCCC----hhhhhhcCCccchHHH
Confidence            45778888877777889999986    6788888999998764


No 10 
>PF13822 ACC_epsilon:  Acyl-CoA carboxylase epsilon subunit
Probab=41.73  E-value=14  Score=22.43  Aligned_cols=9  Identities=22%  Similarity=0.678  Sum_probs=7.6

Q ss_pred             cCChHHHHH
Q 043175           10 QPSNEQIFC   18 (139)
Q Consensus        10 ~PtDeELi~   18 (139)
                      +||||||-.
T Consensus        10 nPt~eElAA   18 (62)
T PF13822_consen   10 NPTDEELAA   18 (62)
T ss_pred             CCCHHHHHH
Confidence            799999865


No 11 
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=39.24  E-value=22  Score=17.94  Aligned_cols=13  Identities=15%  Similarity=0.263  Sum_probs=10.6

Q ss_pred             ceeEcCChHHHHH
Q 043175            6 GFRFQPSNEQIFC   18 (139)
Q Consensus         6 G~rF~PtDeELi~   18 (139)
                      ....+|+.+|||.
T Consensus         6 kl~~RP~~eeLv~   18 (26)
T smart00707        6 KLSQRPTREELEE   18 (26)
T ss_pred             HHHcCCCHHHHHH
Confidence            3567899999997


No 12 
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid). It has a widespread application as biocatalyst for the synthesis of sialic acid and its derivatives. This enzyme has been shown to be quite specific for pyruvate as the donor, but flexible to a variety of D- and, to some extent, L-hexoses and pentoses as acceptor substrates. NAL is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases.
Probab=37.06  E-value=19  Score=28.23  Aligned_cols=19  Identities=16%  Similarity=-0.106  Sum_probs=14.0

Q ss_pred             CCCceeEcCChHHHHHHHHh
Q 043175            3 SLMGFRFQPSNEQIFCLLEK   22 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~   22 (139)
                      +||- .|.||++||+.||..
T Consensus       103 ~~P~-y~~~~~~~i~~~~~~  121 (288)
T cd00954         103 ITPF-YYKFSFEEIKDYYRE  121 (288)
T ss_pred             eCCC-CCCCCHHHHHHHHHH
Confidence            4554 478999999997653


No 13 
>PLN02417 dihydrodipicolinate synthase
Probab=36.68  E-value=20  Score=28.04  Aligned_cols=18  Identities=17%  Similarity=0.052  Sum_probs=14.4

Q ss_pred             CCCceeEcCChHHHHHHHH
Q 043175            3 SLMGFRFQPSNEQIFCLLE   21 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL   21 (139)
                      +|| +.|.||++||+.||-
T Consensus       103 ~~P-~y~~~~~~~i~~~f~  120 (280)
T PLN02417        103 INP-YYGKTSQEGLIKHFE  120 (280)
T ss_pred             cCC-ccCCCCHHHHHHHHH
Confidence            466 558999999999774


No 14 
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase. This model represents a subset of the DapA (dihydrodipicolinate synthase) family which has apparently evolved a separate function. The product of DapA, dihydrodipicolinate, results from the non-enzymatic cyclization and dehydration of 6-amino-2,4-dihydroxyhept-2-ene-1,7-dioic acid, which is different from the substrate of this reaction only in the presence of the amino group. In the absence of this amino group, and running the reaction in the opposite direction, the reaction corresponds to the HpaI aldolase component of the 4-hydroxyphenylacetic acid catabolism pathway (see TIGR02311). At present, this variant of DapA is found only in Oceanobacillus iheyensis HTE831 and Thermus thermophilus HB27. In both of these cases, one or more other DapA genes can be found and the one identified by this model is part of an operon for 4-hydroxyphenylacetic acid catabolism.
Probab=35.47  E-value=22  Score=28.02  Aligned_cols=19  Identities=11%  Similarity=0.277  Sum_probs=14.4

Q ss_pred             CCCceeEcCChHHHHHHHHh
Q 043175            3 SLMGFRFQPSNEQIFCLLEK   22 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~   22 (139)
                      +||-| |.||+++|+.||-.
T Consensus       102 ~pP~y-~~~~~~~l~~~f~~  120 (294)
T TIGR02313       102 IVPYY-NKPNQEALYDHFAE  120 (294)
T ss_pred             cCccC-CCCCHHHHHHHHHH
Confidence            45554 88999999997643


No 15 
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA). HBPHA catalyzes HBP to salicyaldehyde and pyruvate. This reaction is part of the degradative pathways for naphthalene and naphthalenesulfonates by bacteria. CBPHA is homologous to HBPHA and catalyzes the cleavage of CBP to 2-carboxylbenzaldehyde and pyruvate during the degradation of phenanthrene. They are member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=34.41  E-value=22  Score=28.24  Aligned_cols=18  Identities=0%  Similarity=-0.138  Sum_probs=14.4

Q ss_pred             CCCCceeEcCChHHHHHHH
Q 043175            2 ESLMGFRFQPSNEQIFCLL   20 (139)
Q Consensus         2 ~lp~G~rF~PtDeELi~~y   20 (139)
                      -+|| +.|.||+++|+.||
T Consensus       109 v~~P-~y~~~~~~~l~~yf  126 (309)
T cd00952         109 LGRP-MWLPLDVDTAVQFY  126 (309)
T ss_pred             ECCC-cCCCCCHHHHHHHH
Confidence            3566 56889999999976


No 16 
>PF08338 DUF1731:  Domain of unknown function (DUF1731);  InterPro: IPR013549 This domain of unknown function appears towards the C terminus of proteins of the NAD dependent epimerase/dehydratase family (IPR001509 from INTERPRO) in bacteria, eukaryotes and archaea. Many of the proteins in which it is found are involved in cell-division inhibition. ; PDB: 3OH8_A.
Probab=34.22  E-value=31  Score=19.81  Aligned_cols=16  Identities=38%  Similarity=0.694  Sum_probs=8.8

Q ss_pred             CceeEc-CChHHHHHHH
Q 043175            5 MGFRFQ-PSNEQIFCLL   20 (139)
Q Consensus         5 ~G~rF~-PtDeELi~~y   20 (139)
                      -||+|+ |+=++-+.+.
T Consensus        31 ~GF~F~~p~l~~AL~~l   47 (48)
T PF08338_consen   31 AGFQFRYPTLEEALRDL   47 (48)
T ss_dssp             TT---S-SSHHHHHHH-
T ss_pred             CCCcccCCCHHHHHhcc
Confidence            489998 8877776654


No 17 
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=31.68  E-value=38  Score=15.20  Aligned_cols=8  Identities=25%  Similarity=0.612  Sum_probs=6.4

Q ss_pred             CceEEEEe
Q 043175           58 DRVCYFFC   65 (139)
Q Consensus        58 ~~~~yFF~   65 (139)
                      ++.||||.
T Consensus         7 ~~~wYy~~   14 (19)
T PF01473_consen    7 NGNWYYFD   14 (19)
T ss_dssp             TTEEEEET
T ss_pred             CCEEEEeC
Confidence            57899994


No 18 
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis. It catalyzes the aldol condensation of L-aspartate-beta- semialdehyde and pyruvate to dihydropicolinic acid via a Schiff base formation between pyruvate and a lysine residue. The functional enzyme is a homotetramer consisting of a dimer of dimers. DHDPS is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways.
Probab=31.41  E-value=29  Score=26.97  Aligned_cols=28  Identities=14%  Similarity=0.084  Sum_probs=17.6

Q ss_pred             CCCCceeEcCChHHHHHHHHhHhcCCCCCC
Q 043175            2 ESLMGFRFQPSNEQIFCLLEKKRLNPHFSH   31 (139)
Q Consensus         2 ~lp~G~rF~PtDeELi~~yL~~k~~g~~~~   31 (139)
                      -+||.| |.||++||+.+| +.-+...++|
T Consensus       101 ~~~P~~-~~~~~~~l~~~~-~~ia~~~~~p  128 (284)
T cd00950         101 VVTPYY-NKPSQEGLYAHF-KAIAEATDLP  128 (284)
T ss_pred             Eccccc-CCCCHHHHHHHH-HHHHhcCCCC
Confidence            356754 789999999855 4344433343


No 19 
>TIGR00674 dapA dihydrodipicolinate synthase. Dihydrodipicolinate synthase is a homotetrameric enzyme of lysine biosynthesis. E. coli has several paralogs closely related to dihydrodipicoline synthase (DapA), as well as the more distant N-acetylneuraminate lyase. In Pyrococcus horikoshii, the bidirectional best hit with E. coli is to an uncharacterized paralog of DapA, not DapA itself, and it is omitted from the seed. The putative members from the Chlamydias (pathogens with a parasitic metabolism) are easily the most divergent members of the multiple alignment.
Probab=29.71  E-value=35  Score=26.60  Aligned_cols=19  Identities=11%  Similarity=0.240  Sum_probs=14.3

Q ss_pred             CCCceeEcCChHHHHHHHHh
Q 043175            3 SLMGFRFQPSNEQIFCLLEK   22 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~   22 (139)
                      +||-| |.||++||+.||..
T Consensus       100 ~pP~y-~~~~~~~i~~~~~~  118 (285)
T TIGR00674       100 VTPYY-NKPTQEGLYQHFKA  118 (285)
T ss_pred             cCCcC-CCCCHHHHHHHHHH
Confidence            45554 78999999997754


No 20 
>PRK03170 dihydrodipicolinate synthase; Provisional
Probab=29.33  E-value=34  Score=26.76  Aligned_cols=27  Identities=11%  Similarity=0.066  Sum_probs=17.3

Q ss_pred             CCCceeEcCChHHHHHHHHhHhcCCCCCC
Q 043175            3 SLMGFRFQPSNEQIFCLLEKKRLNPHFSH   31 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~~k~~g~~~~   31 (139)
                      +||-| |.|++++|+.+| ..-+..-++|
T Consensus       103 ~pP~~-~~~~~~~i~~~~-~~ia~~~~~p  129 (292)
T PRK03170        103 VTPYY-NKPTQEGLYQHF-KAIAEATDLP  129 (292)
T ss_pred             CCCcC-CCCCHHHHHHHH-HHHHhcCCCC
Confidence            56655 889999999865 3344333343


No 21 
>PRK04147 N-acetylneuraminate lyase; Provisional
Probab=26.84  E-value=37  Score=26.65  Aligned_cols=27  Identities=11%  Similarity=-0.085  Sum_probs=16.8

Q ss_pred             CCCceeEcCChHHHHHHHHhHhcCCCCCC
Q 043175            3 SLMGFRFQPSNEQIFCLLEKKRLNPHFSH   31 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~~k~~g~~~~   31 (139)
                      +||- -|.||+++|+.||- .-+...++|
T Consensus       106 ~~P~-y~~~~~~~l~~~f~-~va~a~~lP  132 (293)
T PRK04147        106 VTPF-YYPFSFEEICDYYR-EIIDSADNP  132 (293)
T ss_pred             eCCc-CCCCCHHHHHHHHH-HHHHhCCCC
Confidence            3444 48899999998654 344433444


No 22 
>PF07131 DUF1382:  Protein of unknown function (DUF1382);  InterPro: IPR009814 This entry is represented by Bacteriophage lambda, Xis. This entry overlaps with IPR009750, both representing lambda Xis. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical Escherichia coli and Bacteriophage lambda-like proteins of around 60 residues in length. The function of this family is unknown.
Probab=26.54  E-value=47  Score=20.22  Aligned_cols=14  Identities=36%  Similarity=0.888  Sum_probs=10.2

Q ss_pred             CceeEcC----ChHHHHH
Q 043175            5 MGFRFQP----SNEQIFC   18 (139)
Q Consensus         5 ~G~rF~P----tDeELi~   18 (139)
                      .|+||.|    ||+|+..
T Consensus        22 ~GIRFVpiPv~~dee~~~   39 (61)
T PF07131_consen   22 IGIRFVPIPVVTDEEFHT   39 (61)
T ss_pred             cCceeeccccccHHHHHH
Confidence            4899998    5666543


No 23 
>PF09174 Maf1:  Maf1 regulator;  InterPro: IPR015257 Maf1 is a negative regulator of RNA polymerase III [, ]. It targets the initiation factor TFIIIB []. ; PDB: 3NR5_A.
Probab=23.98  E-value=18  Score=26.69  Aligned_cols=13  Identities=23%  Similarity=0.100  Sum_probs=6.8

Q ss_pred             eeecCCCCCCCcC
Q 043175           35 KDIDDICGLEPWD   47 (139)
Q Consensus        35 I~~~Dvy~~~P~~   47 (139)
                      +.+||||...|..
T Consensus       137 l~~C~iYsy~pd~  149 (179)
T PF09174_consen  137 LKDCDIYSYNPDS  149 (179)
T ss_dssp             GGG-EEEEE---G
T ss_pred             ccCceEEEEccCC
Confidence            4579999999843


No 24 
>PF12672 DUF3793:  Protein of unknown function (DUF3793);  InterPro: IPR024523 This family of bacterial proteins is functionally uncharacterised. The proteins in this family contain two conserved sequence motifs: PHE and LGYP.
Probab=23.41  E-value=53  Score=24.13  Aligned_cols=39  Identities=23%  Similarity=0.120  Sum_probs=24.1

Q ss_pred             ceeEcCChHHHHHHHHhHhcCCCCCCCCeeeecCCC-CCCCcCccc
Q 043175            6 GFRFQPSNEQIFCLLEKKRLNPHFSHHTIKDIDDIC-GLEPWDLAG   50 (139)
Q Consensus         6 G~rF~PtDeELi~~yL~~k~~g~~~~~~~I~~~Dvy-~~~P~~L~~   50 (139)
                      ||  .+.+-+-+...|+.+......|    ||+-|+ +++..|..+
T Consensus        83 GY--~~~~~~~~L~~L~~R~~~~~FP----HEIGiFLGYPleDV~G  122 (176)
T PF12672_consen   83 GY--PDSSLEDCLEHLKKRFESGEFP----HEIGIFLGYPLEDVKG  122 (176)
T ss_pred             Cc--CCCCHHHHHHHHHHHhcCCCCC----chhHhccCCCHHHHHH
Confidence            56  5555444445787787655566    467766 666666644


No 25 
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro-4-deoxyglucarate dehydratase not only catalyzes the dehydration of the substrate (diol to ketone + water), but causes the decarboxylation of the intermediate product to yield 2-oxoglutarate semialdehyde (2,5-dioxopentanoate). The gene for the enzyme is usually observed in the vicinity of transporters and dehydratases handling D-galactarate and D-gluconate as well as aldehyde dehydrogenases which convert the product to alpha-ketoglutarate.
Probab=23.34  E-value=50  Score=25.98  Aligned_cols=27  Identities=7%  Similarity=0.011  Sum_probs=17.0

Q ss_pred             CCCceeEcCChHHHHHHHHhHhcCCCCCC
Q 043175            3 SLMGFRFQPSNEQIFCLLEKKRLNPHFSH   31 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~~k~~g~~~~   31 (139)
                      +|| |-|.||+++|+.||-. -+...++|
T Consensus       106 ~pP-~y~~~s~~~i~~~f~~-v~~a~~~p  132 (296)
T TIGR03249       106 LPP-YLINGEQEGLYAHVEA-VCESTDLG  132 (296)
T ss_pred             CCC-CCCCCCHHHHHHHHHH-HHhccCCC
Confidence            566 4477999999996643 33333344


No 26 
>PF02755 RPEL:  RPEL repeat;  InterPro: IPR004018 The RPEL repeat is named after four conserved amino acids it contains. The function of the RPEL repeat is unknown however it might be a DNA binding repeat based on the observation that Q9VZY2 from SWISSPROT contains a SAP domain that is also implicated in DNA binding.; PDB: 2YJE_M 2V52_M 2YJF_M 2V51_E.
Probab=22.93  E-value=51  Score=16.52  Aligned_cols=10  Identities=20%  Similarity=0.451  Sum_probs=5.8

Q ss_pred             EcCChHHHHH
Q 043175            9 FQPSNEQIFC   18 (139)
Q Consensus         9 F~PtDeELi~   18 (139)
                      .+|+-+|||.
T Consensus         9 ~RP~~~eLv~   18 (26)
T PF02755_consen    9 QRPTREELVE   18 (26)
T ss_dssp             T---HHHHHH
T ss_pred             cCCCHHHHHH
Confidence            4799999987


No 27 
>COG2326 Uncharacterized conserved protein [Function unknown]
Probab=22.66  E-value=76  Score=25.15  Aligned_cols=28  Identities=11%  Similarity=0.000  Sum_probs=21.9

Q ss_pred             CCceeEc----CChHHHHHHHHhHhcCCCCCC
Q 043175            4 LMGFRFQ----PSNEQIFCLLEKKRLNPHFSH   31 (139)
Q Consensus         4 p~G~rF~----PtDeELi~~yL~~k~~g~~~~   31 (139)
                      |-|+|-.    |||+|+-..||.+-+..-|-.
T Consensus       100 PR~~rvval~aPt~~E~~qwY~qRy~~~lPa~  131 (270)
T COG2326         100 PRGARVVALPAPTDRERGQWYFQRYVAHLPAA  131 (270)
T ss_pred             CceeEEeecCCCChHhhccHHHHHHHHhCCCC
Confidence            5566643    999999999999998866543


No 28 
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=22.41  E-value=80  Score=16.10  Aligned_cols=19  Identities=11%  Similarity=-0.024  Sum_probs=14.3

Q ss_pred             ChHHHHHHHHhHhcCCCCC
Q 043175           12 SNEQIFCLLEKKRLNPHFS   30 (139)
Q Consensus        12 tDeELi~~yL~~k~~g~~~   30 (139)
                      +-.|||.+|+.-|+...-.
T Consensus         4 ~nR~lV~~yi~yKLsQrgy   22 (27)
T PF02180_consen    4 DNRELVEDYISYKLSQRGY   22 (27)
T ss_dssp             HHHHHHHHHHHHHHHHTTS
T ss_pred             cHHHHHHHHHHHHhhhcCC
Confidence            4579999999888765443


No 29 
>PRK14390 hypothetical protein; Provisional
Probab=22.32  E-value=39  Score=20.79  Aligned_cols=43  Identities=12%  Similarity=-0.072  Sum_probs=22.3

Q ss_pred             CCCceeEcCChHHHHHHHHhHhcCCCCCCCCeeeecCCCCCCCcCc
Q 043175            3 SLMGFRFQPSNEQIFCLLEKKRLNPHFSHHTIKDIDDICGLEPWDL   48 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~~k~~g~~~~~~~I~~~Dvy~~~P~~L   48 (139)
                      +|+-+||.||=-|=...=+.+.   ..+........-|..+|||--
T Consensus        13 ~~~~CRf~PTCS~Ya~~Ai~~~---G~~kG~~l~~~RilRC~P~~~   55 (63)
T PRK14390         13 FGPRCRFIPSCSSYGYEAITRH---GPWKGGWLTLRRLSRCHPLTP   55 (63)
T ss_pred             CCCCCCcCccHHHHHHHHHHHh---CcHHHHHHHHHHHhcCCCCCC
Confidence            6788999999655333222211   112222333345556777643


No 30 
>cd00408 DHDPS-like Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stablilzes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.
Probab=22.01  E-value=55  Score=25.23  Aligned_cols=27  Identities=15%  Similarity=-0.036  Sum_probs=16.6

Q ss_pred             CCCceeEcCChHHHHHHHHhHhcCCCCCC
Q 043175            3 SLMGFRFQPSNEQIFCLLEKKRLNPHFSH   31 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~~k~~g~~~~   31 (139)
                      +||- .|.||+++++.+|.. -+...++|
T Consensus        99 ~pP~-y~~~~~~~~~~~~~~-ia~~~~~p  125 (281)
T cd00408          99 VPPY-YNKPSQEGIVAHFKA-VADASDLP  125 (281)
T ss_pred             CCCc-CCCCCHHHHHHHHHH-HHhcCCCC
Confidence            4554 467999999996543 44433344


No 31 
>PF02375 JmjN:  jmjN domain;  InterPro: IPR003349 Jumonji protein is required for neural tube formation in mice [].There is evidence of domain swapping within the jumonji family of transcription factors []. This domain is often associated with JmjC (see IPR003347 from INTERPRO).; PDB: 2XML_A 2W2I_C 3DXT_A 3DXU_A 2OX0_B 2OQ6_B 2WWJ_A 2Q8D_A 3PDQ_A 2YBK_A ....
Probab=22.00  E-value=45  Score=17.84  Aligned_cols=11  Identities=27%  Similarity=0.304  Sum_probs=5.2

Q ss_pred             eEcCChHHHHH
Q 043175            8 RFQPSNEQIFC   18 (139)
Q Consensus         8 rF~PtDeELi~   18 (139)
                      -|.||.||.-+
T Consensus         2 vf~Pt~eEF~d   12 (34)
T PF02375_consen    2 VFYPTMEEFKD   12 (34)
T ss_dssp             EE---HHHHS-
T ss_pred             cccCCHHHHhC
Confidence            48999999754


No 32 
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional
Probab=21.59  E-value=52  Score=26.01  Aligned_cols=27  Identities=7%  Similarity=-0.083  Sum_probs=17.3

Q ss_pred             CCCceeEcCChHHHHHHHHhHhcCCCCCC
Q 043175            3 SLMGFRFQPSNEQIFCLLEKKRLNPHFSH   31 (139)
Q Consensus         3 lp~G~rF~PtDeELi~~yL~~k~~g~~~~   31 (139)
                      +|| +.|.||+++|+.||-. -+...++|
T Consensus       108 ~pP-~y~~~~~~~i~~~f~~-va~~~~lp  134 (303)
T PRK03620        108 LPP-YLTEAPQEGLAAHVEA-VCKSTDLG  134 (303)
T ss_pred             CCC-CCCCCCHHHHHHHHHH-HHHhCCCC
Confidence            455 5678999999997643 33333444


No 33 
>COG4802 FtrB Ferredoxin-thioredoxin reductase, catalytic subunit [Energy production and conversion]
Probab=20.08  E-value=85  Score=21.31  Aligned_cols=31  Identities=10%  Similarity=0.146  Sum_probs=18.1

Q ss_pred             CceeEcCChHHHHHHHHhHhcC-----CCC-CCCCeee
Q 043175            5 MGFRFQPSNEQIFCLLEKKRLN-----PHF-SHHTIKD   36 (139)
Q Consensus         5 ~G~rF~PtDeELi~~yL~~k~~-----g~~-~~~~~I~   36 (139)
                      .|++|+|.- |++...|+-.+.     |.+ .|++++.
T Consensus        20 sG~~lnpD~-e~~~~v~~gL~~~ke~yG~~~CPCRl~~   56 (110)
T COG4802          20 SGYRLNPDR-EFTAEVLRGLASNKERYGYPSCPCRLVT   56 (110)
T ss_pred             cCceeCCCH-HHHHHHHHHHHHhHHHhCCCCCCeeccc
Confidence            589999965 444445554443     455 4555553


Done!