BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 043252
         (337 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1F48|A Chain A, Crystal Structure Of The Escherichia Coli
           Arsenite-Translocating Atpase
 pdb|1IHU|A Chain A, Crystal Structure Of The Escherichia Coli
           Arsenite-Translocating Atpase In Complex With
           Mg-Adp-Alf3
 pdb|1II0|A Chain A, Crystal Structure Of The Escherichia Coli
           Arsenite-Translocating Atpase
 pdb|1II0|B Chain B, Crystal Structure Of The Escherichia Coli
           Arsenite-Translocating Atpase
 pdb|1II9|A Chain A, Crystal Structure Of The Escherichia Coli Arsenite-
           Translocating Atpase In Complex With Amp-Pnp
 pdb|1II9|B Chain B, Crystal Structure Of The Escherichia Coli Arsenite-
           Translocating Atpase In Complex With Amp-Pnp
          Length = 589

 Score = 28.5 bits (62), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%), Gaps = 2/32 (6%)

Query: 205 LLKDDSRNDGGFSVIPIIGMGGLGKTTLAQLV 236
           L+ D +RN+ G   I ++G GG+GKTT+A  +
Sbjct: 318 LVDDIARNEHGL--IMLMGKGGVGKTTMAAAI 347


>pdb|3QFL|A Chain A, Coiled-Coil Domain-Dependent Homodimerization Of
          Intracellular Mla Immune Receptors Defines A Minimal
          Functional Module For Triggering Cell Death
          Length = 115

 Score = 27.7 bits (60), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 18/25 (72%)

Query: 62 DDSVKLWLGELQNLAYDVEDLLDEF 86
          D   KLW  E++ L+Y +ED++D+F
Sbjct: 54 DSQDKLWADEVRELSYVIEDVVDKF 78


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.134    0.380 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,281,283
Number of Sequences: 62578
Number of extensions: 296669
Number of successful extensions: 955
Number of sequences better than 100.0: 19
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 18
Number of HSP's that attempted gapping in prelim test: 952
Number of HSP's gapped (non-prelim): 21
length of query: 337
length of database: 14,973,337
effective HSP length: 99
effective length of query: 238
effective length of database: 8,778,115
effective search space: 2089191370
effective search space used: 2089191370
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)